Recombinant Full Length Human MMACHC Protein, GST-tagged

Cat.No. : MMACHC-6386HF
Product Overview : Human MMACHC full-length ORF ( AAH06122.3, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 225 amino acids
Description : The exact function of the protein encoded by this gene is not known, however, its C-terminal region shows similarity to TonB, a bacterial protein involved in energy transduction for cobalamin (vitamin B12) uptake. Hence, it is postulated that this protein may have a role in the binding and intracellular trafficking of cobalamin. Mutations in this gene are associated with methylmalonic aciduria and homocystinuria type cblC. [provided by RefSeq, Oct 2009]
Molecular Mass : 51.7 kDa
AA Sequence : MFDRALKPFLQSCHLRMLTDPVDQCVAYHLGRVRESLPELQIEIIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVEADPWGNQRISGVCIHPRFGGWFAIRGVVLLPGIEVPDLPPRKPHDCVPTRADRIALLEGFNFHWRDWTYRDAVTPQERYSEEQKAYFSTPPAQRLALLGLAQPSEKPSSPSPDLPFTTPAPKKPGNPSRARSWLSPRVSPPASPGP
Applications : Antibody Production
Functional Study
Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MMACHC methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria [ Homo sapiens ]
Official Symbol MMACHC
Synonyms MMACHC; methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria; methylmalonic aciduria and homocystinuria type C protein; cblC; DKFZP564I122; FLJ25671; RP11-291L19.3; DKFZp564I122;
Gene ID 25974
mRNA Refseq NM_015506
Protein Refseq NP_056321
MIM 609831
UniProt ID Q9Y4U1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MMACHC Products

Required fields are marked with *

My Review for All MMACHC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon