Recombinant Full Length Human MMP14 Protein, GST-tagged
Cat.No. : | MMP14-6464HF |
Product Overview : | Human MMP14 full-length ORF ( AAH64803.1, 1 a.a. - 582 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 582 amino acids |
Description : | Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the protein encoded by this gene is a member of the membrane-type MMP (MT-MMP) subfamily; each member of this subfamily contains a potential transmembrane domain suggesting that these proteins are expressed at the cell surface rather than secreted. This protein activates MMP2 protein, and this activity may be involved in tumor invasion. [provided by RefSeq |
Molecular Mass : | 92.3 kDa |
AA Sequence : | MSPAPRPSRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MMP14 matrix metallopeptidase 14 (membrane-inserted) [ Homo sapiens ] |
Official Symbol | MMP14 |
Synonyms | MMP14; matrix metallopeptidase 14 (membrane-inserted); matrix metalloproteinase 14 (membrane inserted); matrix metalloproteinase-14; membrane type 1 metalloprotease; MT1 MMP; membrane-type matrix metalloproteinase 1; membrane-type-1 matrix metalloproteinase; matrix metalloproteinase 14 (membrane-inserted); 1; MMP-14; MMP-X1; MT-MMP; MT1MMP; MTMMP1; MT1-MMP; MT-MMP 1; |
Gene ID | 4323 |
mRNA Refseq | NM_004995 |
Protein Refseq | NP_004986 |
MIM | 600754 |
UniProt ID | P50281 |
◆ Recombinant Proteins | ||
Mmp14-4098M | Recombinant Mouse Mmp14 Protein, Myc/DDK-tagged | +Inquiry |
MMP14-3649H | Recombinant Human MMP14 protein, His-tagged | +Inquiry |
MMP14-4576H | Recombinant Human MMP14 Protein (Pro316-Gly511), N-His tagged | +Inquiry |
MMP14-1787HFL | Recombinant Full Length Human MMP14 Protein, C-Flag-tagged | +Inquiry |
MMP14-812H | Recombinant Human MMP14, Hemopexin Domain, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP14-4279HCL | Recombinant Human MMP14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP14 Products
Required fields are marked with *
My Review for All MMP14 Products
Required fields are marked with *