Recombinant Full Length Human MMP19 Protein, GST-tagged
| Cat.No. : | MMP19-6465HF |
| Product Overview : | Human MMP19 full-length ORF ( NP_002420.1, 1 a.a. - 508 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 508 amino acids |
| Description : | Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This protein is expressed in human epidermis and it has a role in cellular proliferation as well as migration and adhesion to type I collagen. Multiple transcript variants encoding distict isoforms have been identified for this gene. [provided by RefSeq |
| Molecular Mass : | 83.8 kDa |
| AA Sequence : | MNCQQLWLGFLLPMTVSGRVLGLAEVAPVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPSTLPPHTARAALRQAFQDWSNVAPLTFQEVQAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHADIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPHFKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPVPTEPSPMPDPCSSELDAMMLGPRGKTYAFKGDYVWTVSDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKGLFTGVPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNISHNWMHCRPRTIDTTPSGGNTTPSGTGITLDTTLSATETTFEY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MMP19 matrix metallopeptidase 19 [ Homo sapiens ] |
| Official Symbol | MMP19 |
| Synonyms | MMP19; matrix metallopeptidase 19; matrix metalloproteinase 19 , MMP18; matrix metalloproteinase-19; RASI 1; MMP-18; MMP-19; matrix metalloproteinase 18; matrix metalloproteinase 19; matrix metalloproteinase-18; matrix metalloproteinase RASI; MMP18; RASI-1; |
| Gene ID | 4327 |
| mRNA Refseq | NM_002429 |
| Protein Refseq | NP_002420 |
| MIM | 601807 |
| UniProt ID | Q99542 |
| ◆ Recombinant Proteins | ||
| MMP19-018H | Recombinant Hamster Matrix metalloproteinase 19 Protein, His tagged | +Inquiry |
| MMP19-4580H | Recombinant Human MMP19 Protein (Tyr98-Tyr508), N-His tagged | +Inquiry |
| Mmp19-4099M | Recombinant Mouse Mmp19 Protein, Myc/DDK-tagged | +Inquiry |
| MMP19-6465HF | Recombinant Full Length Human MMP19 Protein, GST-tagged | +Inquiry |
| Mmp19-1880M | Recombinant Mouse Mmp19 protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MMP19-4277HCL | Recombinant Human MMP19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP19 Products
Required fields are marked with *
My Review for All MMP19 Products
Required fields are marked with *
