Recombinant Full Length Human MMS19 Protein, GST-tagged
Cat.No. : | MMS19-6284HF |
Product Overview : | Human MMS19L full-length ORF ( AAH07298, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 293 amino acids |
Description : | MMS19 (MMS19 Homolog, Cytosolic Iron-Sulfur Assembly Component) is a Protein Coding gene. Among its related pathways are Cytosolic iron-sulfur cluster assembly and Metabolism. GO annotations related to this gene include binding and protein binding, bridging. |
Molecular Mass : | 57.97 kDa |
AA Sequence : | MRELLELSCCHSCPFSSTAAAKCFAGLLNKHPAGQQLDEFLQLAVDKVEAGLGSGPCRSQAFTLLLWVTKALVLRYHPLSSCLTARLMGLLSDPELGPAAADGFSLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVQGFHAAPPDVKPNYLKGLSHVLNRLPKPVLLPELPTLLSLLLEALSCPDCVVQLSTLSCLQPLLLEAPQVMSLHVDTLVTKFLNLSSSPSMAVRIAALQCMHALTRLPTPVLLPYKPQVIRALAKSLDDKKRLVRKEAVSARGEWFLLGSPGS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MMS19 MMS19 nucleotide excision repair homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | MMS19 |
Synonyms | MMS19; MMS19 nucleotide excision repair homolog (S. cerevisiae); MMS19L; MMS19 nucleotide excision repair protein homolog; hMMS19; MET18; MET18 homolog (S. cerevisiae); MET18 homolog; MMS19-like protein; homolog of yeast MMS19; MMS19-like (MET18 homolog, S. cerevisiae); FLJ34167; FLJ95146; MGC99604; |
Gene ID | 64210 |
mRNA Refseq | NM_022362 |
Protein Refseq | NP_071757 |
MIM | 614777 |
UniProt ID | Q96T76 |
◆ Recombinant Proteins | ||
MMS19-9930M | Recombinant Mouse MMS19 Protein | +Inquiry |
MMS19-6284HF | Recombinant Full Length Human MMS19 Protein, GST-tagged | +Inquiry |
MMS19-5609M | Recombinant Mouse MMS19 Protein, His (Fc)-Avi-tagged | +Inquiry |
MMS19-5441H | Recombinant Human MMS19 Protein, GST-tagged | +Inquiry |
MMS19-921H | Recombinant Human MMS19, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMS19-1124HCL | Recombinant Human MMS19 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMS19 Products
Required fields are marked with *
My Review for All MMS19 Products
Required fields are marked with *
0
Inquiry Basket