Recombinant Full Length Human MOCS2 Protein, GST-tagged
Cat.No. : | MOCS2-6300HF |
Product Overview : | Human MOCS2 full-length ORF ( NP_789776.1, 1 a.a. - 88 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 88 amino acids |
Description : | Eukaryotic molybdoenzymes use a unique molybdenum cofactor (MoCo) consisting of a pterin, termed molybdopterin, and the catalytically active metal molybdenum. MoCo is synthesized from precursor Z by the heterodimeric enzyme molybdopterin synthase. The large and small subunits of molybdopterin synthase are both encoded from this gene by overlapping open reading frames. The proteins were initially thought to be encoded from a bicistronic transcript. They are now thought to be encoded from monocistronic transcripts. Alternatively spliced transcripts have been found for this locus that encode the large and small subunits. [provided by RefSeq |
Molecular Mass : | 36.2 kDa |
AA Sequence : | MVPLCQVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIIFAVRQEYVELGDQLLVLQPGDEIAVIPPISGG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MOCS2 molybdenum cofactor synthesis 2 [ Homo sapiens ] |
Official Symbol | MOCS2 |
Synonyms | MOCS2; molybdenum cofactor synthesis 2; molybdopterin synthase catalytic subunit; MOCO1; MOCO1-A; MOCO1-B; MPT synthase large subunit; sulfur carrier protein MOCS2A; molybdopterin-synthase large subunit; molybdopterin-synthase small subunit; molybdenum cofactor synthesis protein 2A; molybdenum cofactor synthesis protein 2B; molybdenum cofactor biosynthesis protein E; molybdopterin synthase sulfur carrier subunit; molybdenum cofactor synthesis protein 2 large subunit; molybdenum cofactor synthesis protein 2 small subunit; MPTS; MCBPE; MOCS2A; MOCS2B; |
Gene ID | 4338 |
mRNA Refseq | NM_004531 |
Protein Refseq | NP_004522 |
MIM | 603708 |
UniProt ID | O96007 |
◆ Recombinant Proteins | ||
MOCS2-6300HF | Recombinant Full Length Human MOCS2 Protein, GST-tagged | +Inquiry |
MOCS2-3726R | Recombinant Rat MOCS2 Protein | +Inquiry |
MOCS2-3238H | Recombinant Human MOCS2 protein, GST-tagged | +Inquiry |
MOCS2-3384R | Recombinant Rat MOCS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MOCS2-9949M | Recombinant Mouse MOCS2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOCS2-4261HCL | Recombinant Human MOCS2 293 Cell Lysate | +Inquiry |
MOCS2-4260HCL | Recombinant Human MOCS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOCS2 Products
Required fields are marked with *
My Review for All MOCS2 Products
Required fields are marked with *
0
Inquiry Basket