Recombinant Full Length Human MORN3 Protein, GST-tagged
| Cat.No. : | MORN3-6312HF | 
| Product Overview : | Human MORN3 full-length ORF (AAH57760.1, 1 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 240 amino acids | 
| Description : | MORN3 (MORN Repeat Containing 3) is a Protein Coding gene. An important paralog of this gene is RSPH10B2. | 
| Molecular Mass : | 52.8 kDa | 
| AA Sequence : | MPVSKCPKKSESLWKGWDRKAQRNGLRSQVYAVNGDYYVGEWEDNVKHGKGTQVWKKKGAIYEGDWKFGKRDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQWENDKPNGEGMLRLKNGNRYEGCWERGMKNGAGRFFHLDHGQLFEGFWVDNMAKCGTMIDFGRDEAPEPTQFPIPEVKILDPDGVLAEALAMFRKTEEGD | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | MORN3 MORN repeat containing 3 [ Homo sapiens (human) ] | 
| Official Symbol | MORN3 | 
| Synonyms | MORN3; MORN repeat containing 3; MORN repeat-containing protein 3; membrane occupation and recognition nexus repeat containing protein | 
| Gene ID | 283385 | 
| mRNA Refseq | NM_173855 | 
| Protein Refseq | NP_776254 | 
| UniProt ID | Q6PF18 | 
| ◆ Recombinant Proteins | ||
| MORN3-1634H | Recombinant Human MORN3 | +Inquiry | 
| Morn3-4117M | Recombinant Mouse Morn3 Protein, Myc/DDK-tagged | +Inquiry | 
| MORN3-447C | Recombinant Cynomolgus Monkey MORN3 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| MORN3-701C | Recombinant Cynomolgus MORN3 Protein, His-tagged | +Inquiry | 
| MORN3-3495H | Recombinant Human MORN3 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| MORN3-4250HCL | Recombinant Human MORN3 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MORN3 Products
Required fields are marked with *
My Review for All MORN3 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            