Recombinant Full Length Human MORN4 Protein, GST-tagged

Cat.No. : MORN4-6313HF
Product Overview : Human MORN4 full-length ORF ( NP_849154.1, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 146 amino acids
Description : MORN4 (MORN Repeat Containing 4) is a Protein Coding gene.
Molecular Mass : 42.6 kDa
AA Sequence : MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLMFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGEFAQGKFNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MORN4 MORN repeat containing 4 [ Homo sapiens ]
Official Symbol MORN4
Synonyms MORN4; MORN repeat containing 4; C10orf83, chromosome 10 open reading frame 83; MORN repeat-containing protein 4; 44050 protein; bA548K23.4; FLJ25925; retinophilin; protein 44050; C10orf83; RP11-548K23.4;
Gene ID 118812
mRNA Refseq NM_001098831
Protein Refseq NP_001092301
MIM 617736
UniProt ID Q8NDC4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MORN4 Products

Required fields are marked with *

My Review for All MORN4 Products

Required fields are marked with *

0
cart-icon