Recombinant Full Length Human MORN4 Protein, GST-tagged
| Cat.No. : | MORN4-6313HF | 
| Product Overview : | Human MORN4 full-length ORF ( NP_849154.1, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 146 amino acids | 
| Description : | MORN4 (MORN Repeat Containing 4) is a Protein Coding gene. | 
| Molecular Mass : | 42.6 kDa | 
| AA Sequence : | MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLMFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGEFAQGKFNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTA | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | MORN4 MORN repeat containing 4 [ Homo sapiens ] | 
| Official Symbol | MORN4 | 
| Synonyms | MORN4; MORN repeat containing 4; C10orf83, chromosome 10 open reading frame 83; MORN repeat-containing protein 4; 44050 protein; bA548K23.4; FLJ25925; retinophilin; protein 44050; C10orf83; RP11-548K23.4; | 
| Gene ID | 118812 | 
| mRNA Refseq | NM_001098831 | 
| Protein Refseq | NP_001092301 | 
| MIM | 617736 | 
| UniProt ID | Q8NDC4 | 
| ◆ Recombinant Proteins | ||
| MORN4-5483H | Recombinant Human MORN4 Protein, GST-tagged | +Inquiry | 
| MORN4-2339Z | Recombinant Zebrafish MORN4 | +Inquiry | 
| MORN4-5638M | Recombinant Mouse MORN4 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| MORN4-2989C | Recombinant Chicken MORN4 | +Inquiry | 
| MORN4-6313HF | Recombinant Full Length Human MORN4 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| MORN4-4249HCL | Recombinant Human MORN4 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MORN4 Products
Required fields are marked with *
My Review for All MORN4 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            