Recombinant Full Length Human MPZL1 Protein, GST-tagged
Cat.No. : | MPZL1-6338HF |
Product Overview : | Human MPZL1 full-length ORF ( AAH07881, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 269 amino acids |
Description : | MPZL1 (Myelin Protein Zero Like 1) is a Protein Coding gene. Diseases associated with MPZL1 include Noonan Syndrome 1. Among its related pathways are Cell adhesion molecules (CAMs) and Tyrosine Kinases / Adaptors. GO annotations related to this gene include structural molecule activity. An important paralog of this gene is MPZ. |
Molecular Mass : | 55.33 kDa |
AA Sequence : | MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MPZL1 myelin protein zero-like 1 [ Homo sapiens ] |
Official Symbol | MPZL1 |
Synonyms | MPZL1; myelin protein zero-like 1; myelin protein zero-like protein 1; FLJ21047; PZR; protein zero related; protein zero-related; immunoglobulin family transmembrane protein; PZRa; PZRb; PZR1b; MPZL1b; |
Gene ID | 9019 |
mRNA Refseq | NM_001146191 |
Protein Refseq | NP_001139663 |
MIM | 604376 |
UniProt ID | O95297 |
◆ Recombinant Proteins | ||
MPZL1-3745R | Recombinant Rat MPZL1 Protein | +Inquiry |
MPZL1-10005M | Recombinant Mouse MPZL1 Protein | +Inquiry |
MPZL1-15869H | Recombinant Human MPZL1, His-tagged | +Inquiry |
MPZL1-5659M | Recombinant Mouse MPZL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MPZL1-3403R | Recombinant Rat MPZL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPZL1-4218HCL | Recombinant Human MPZL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPZL1 Products
Required fields are marked with *
My Review for All MPZL1 Products
Required fields are marked with *
0
Inquiry Basket