Recombinant Full Length Human MRI1 Protein, C-Flag-tagged
Cat.No. : | MRI1-1617HFL |
Product Overview : | Recombinant Full Length Human MRI1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This enzyme functions in the methionine salvage pathway by catalyzing the interconversion of methylthioribose-1-phosphate and methythioribulose-1-phosphate. Elevated expression of the encoded protein is associated with metastatic melanoma and this protein promotes melanoma cell invasion independent of its enzymatic activity. Mutations in this gene may be associated with vanishing white matter disease (VMWD). |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39 kDa |
AA Sequence : | MTLEAIRYSRGSLQILDQLLLPKQSRYEAVGSVHQAWEAIRAMKVRGAPAIALVGCLSLAVELQAGAGGP GLAALVAFVRDKLSFLVTARPTAVNMARAARDLADVAAREAEREGATEEAVRERVICCTEDMLEKDLRDN RSIGDLGARHLLERVAPSGGKVTVLTHCNTGALATAGYGTALGVIRSLHSLGRLEHAFCTETRPYNQGAR LTAFELVYEQIPATLITDSMVAAAMAHRGVSAVVVGADRVVANGDTANKVGTYQLAIVAKHHGIPFYVAA PSSSCDLRLETGKEIIIEERPGQELTDVNGVRIAAPGIGVWNPAFDVTPHDLITGGIITELGVFAPEELR TALTTTISSRDGTLDGPQMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | MRI1 methylthioribose-1-phosphate isomerase 1 [ Homo sapiens (human) ] |
Official Symbol | MRI1 |
Synonyms | M1Pi; MRDI; MTNA; Ypr118w |
Gene ID | 84245 |
mRNA Refseq | NM_001031727.4 |
Protein Refseq | NP_001026897.1 |
MIM | 615105 |
UniProt ID | Q9BV20 |
◆ Recombinant Proteins | ||
Mri1-4141M | Recombinant Mouse Mri1 Protein, Myc/DDK-tagged | +Inquiry |
MRI1-1551H | Recombinant Human MRI1 Protein, MYC/DDK-tagged | +Inquiry |
MRI1-4326H | Recombinant Human MRI1 Protein, GST-tagged | +Inquiry |
MRI1-3420R | Recombinant Rat MRI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRI1-10038M | Recombinant Mouse MRI1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRI1-4203HCL | Recombinant Human MRI1 293 Cell Lysate | +Inquiry |
MRI1-4202HCL | Recombinant Human MRI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRI1 Products
Required fields are marked with *
My Review for All MRI1 Products
Required fields are marked with *
0
Inquiry Basket