Recombinant Full Length Human MRPL52 Protein, C-Flag-tagged

Cat.No. : MRPL52-1797HFL
Product Overview : Recombinant Full Length Human MRPL52 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein which has no bacterial homolog. Multiple transcript variants encoding different protein isoforms were identified through sequence analysis.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 13.5 kDa
AA Sequence : MAALGTVLFTGVRRLHCSAAAWAGGQWRLQQGLAANPSGYGPLTELPDCSYADGRPAPPMKGQLRRKAER ETFARRVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENALKPKGASLKSPLPSQ myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name MRPL52 mitochondrial ribosomal protein L52 [ Homo sapiens (human) ]
Official Symbol MRPL52
Synonyms mitochondrial ribosomal protein L52; OTTHUMP00000164489
Gene ID 122704
mRNA Refseq NM_178336.3
Protein Refseq NP_848026.1
MIM 611856
UniProt ID Q86TS9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRPL52 Products

Required fields are marked with *

My Review for All MRPL52 Products

Required fields are marked with *

0
cart-icon
0
compare icon