Recombinant Full Length Human MRPS14 Protein, GST-tagged
Cat.No. : | MRPS14-6466HF |
Product Overview : | Human MRPS14 full-length ORF ( NP_071383.1, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 128 amino acids |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S14P family. [provided by RefSeq |
Molecular Mass : | 41.5 kDa |
AA Sequence : | MAAFMLGSLLRTFKQMVPSSASGQVRSHYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRATW |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPS14 mitochondrial ribosomal protein S14 [ Homo sapiens (human) ] |
Official Symbol | MRPS14 |
Synonyms | MRPS14; mitochondrial ribosomal protein S14; S14mt; MRP-S14; HSMRPS14; DJ262D12.2; 28S ribosomal protein S14, mitochondrial; mitochondrial 28S ribosomal protein S14; mitochondrial small ribosomal subunit protein uS14m; EC 3.6.5.3 |
Gene ID | 63931 |
mRNA Refseq | NM_022100 |
Protein Refseq | NP_071383 |
MIM | 611978 |
UniProt ID | O60783 |
◆ Recombinant Proteins | ||
MRPS14-5713M | Recombinant Mouse MRPS14 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS14-3522H | Recombinant Human MRPS14 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS14-6466HF | Recombinant Full Length Human MRPS14 Protein, GST-tagged | +Inquiry |
MRPS14-4336Z | Recombinant Zebrafish MRPS14 | +Inquiry |
MRPS14-10086M | Recombinant Mouse MRPS14 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS14-4151HCL | Recombinant Human MRPS14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRPS14 Products
Required fields are marked with *
My Review for All MRPS14 Products
Required fields are marked with *
0
Inquiry Basket