Recombinant Full Length Human MRPS15 Protein, GST-tagged
Cat.No. : | MRPS15-6467HF |
Product Overview : | Human MRPS15 full-length ORF (BAG37829.1, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 257 amino acids |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S15P family. The encoded protein is more than two times the size of its E. coli counterpart, with the 12S rRNA binding sites conserved. Between human and mouse, the encoded protein is the least conserved among small subunit ribosomal proteins. Pseudogenes corresponding to this gene are found on chromosomes 15q and 19q. |
Molecular Mass : | 54.67 kDa |
AA Sequence : | MLRVAWRTLSLIRTRAVTQVLVPGLPGGGSAKFPFNQWGLQPRSLLLQAARGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANKKEMLKIKQEQFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMSIDQRKKMLKNLRNTNYDVFEKICWGLGIEYTFPPLYYRRAHRRFVTKKALCIRVFQETQKLKKRRRALKAAAAAQKQAKRRNPDSPAKAIPKTLKDSQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPS15 mitochondrial ribosomal protein S15 [ Homo sapiens ] |
Official Symbol | MRPS15 |
Synonyms | MRPS15; mitochondrial ribosomal protein S15; 28S ribosomal protein S15, mitochondrial; FLJ11564; MRP-S15; DC37; S15mt; RPMS15; MPR-S15; |
Gene ID | 64960 |
mRNA Refseq | NM_031280 |
Protein Refseq | NP_112570 |
MIM | 611979 |
UniProt ID | P82914 |
◆ Recombinant Proteins | ||
MRPS15-1942H | Recombinant Human MRPS15 Protein, His-tagged | +Inquiry |
MRPS15-5603H | Recombinant Human MRPS15 Protein, GST-tagged | +Inquiry |
MRPS15-3778R | Recombinant Rat MRPS15 Protein | +Inquiry |
MRPS15-6732H | Recombinant Human MRPS15 protein, His-tagged | +Inquiry |
MRPS15-613Z | Recombinant Zebrafish MRPS15 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS15-4150HCL | Recombinant Human MRPS15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS15 Products
Required fields are marked with *
My Review for All MRPS15 Products
Required fields are marked with *