Recombinant Full Length Human MRPS17 Protein, GST-tagged
Cat.No. : | MRPS17-6471HF |
Product Overview : | Human MRPS17 full-length ORF ( AAH54031, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 130 amino acids |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S17P family. The encoded protein is moderately conserved between human mitochondrial and prokaryotic ribosomal proteins. Pseudogenes corresponding to this gene are found on chromosomes 1p, 3p, 6q, 14p, 18q, and Xq. [provided by RefSeq |
Molecular Mass : | 40.04 kDa |
AA Sequence : | MSVVRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTTYLESPLSSETTQLSKNLEELNISSAQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPS17 mitochondrial ribosomal protein S17 [ Homo sapiens ] |
Official Symbol | MRPS17 |
Synonyms | MRPS17; mitochondrial ribosomal protein S17; 28S ribosomal protein S17, mitochondrial; 28S ribosomal protein S17; mitochondrial; HSPC011; MRP S17; RPMS17; S17mt; MRP-S17; |
Gene ID | 51373 |
mRNA Refseq | NM_015969 |
Protein Refseq | NP_057053 |
MIM | 611980 |
UniProt ID | Q9Y2R5 |
◆ Recombinant Proteins | ||
Mrps17-4166M | Recombinant Mouse Mrps17 Protein, Myc/DDK-tagged | +Inquiry |
MRPS17-30156H | Recombinant Human MRPS17 protein, GST-tagged | +Inquiry |
MRPS17-5605H | Recombinant Human MRPS17 Protein, GST-tagged | +Inquiry |
MRPS17-5715M | Recombinant Mouse MRPS17 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS17-2676R | Recombinant Rhesus Macaque MRPS17 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS17 Products
Required fields are marked with *
My Review for All MRPS17 Products
Required fields are marked with *
0
Inquiry Basket