Recombinant Full Length Human MRPS24 Protein, GST-tagged
Cat.No. : | MRPS24-6489HF |
Product Overview : | Human MRPS24 full-length ORF ( NP_114403.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 167 amino acids |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. A pseudogene corresponding to this gene is found on chromosome 11. [provided by RefSeq |
Molecular Mass : | 45.4 kDa |
AA Sequence : | MAASVCSGLLGPRVLSWSRELPCAWRALHTSPVCAKNRAARVRVSKGDKPVTYEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTVEDVFLRKFMWGTFPGCLADQLVLKRRGNQLEICAVVLRQLSPHKYYFLVGYSETLLSYFYKCPVRLHLQTVPSKVVYKYL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPS24 mitochondrial ribosomal protein S24 [ Homo sapiens ] |
Official Symbol | MRPS24 |
Synonyms | MRPS24; mitochondrial ribosomal protein S24; 28S ribosomal protein S24, mitochondrial; HSPC335; MRP S24; mitochondrial 28S ribosomal protein S24; S24mt; bMRP47; MRP-S24; bMRP-47; |
Gene ID | 64951 |
mRNA Refseq | NM_032014 |
Protein Refseq | NP_114403 |
MIM | 611986 |
UniProt ID | Q96EL2 |
◆ Recombinant Proteins | ||
MRPS24-5720M | Recombinant Mouse MRPS24 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS24-6489HF | Recombinant Full Length Human MRPS24 Protein, GST-tagged | +Inquiry |
MRPS24-10096M | Recombinant Mouse MRPS24 Protein | +Inquiry |
MRPS24-2846Z | Recombinant Zebrafish MRPS24 | +Inquiry |
MRPS24-5613H | Recombinant Human MRPS24 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS24-4142HCL | Recombinant Human MRPS24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS24 Products
Required fields are marked with *
My Review for All MRPS24 Products
Required fields are marked with *