Recombinant Human MRPS24 Protein, GST-tagged

• Cat.No.: MRPS24-5613H
• Product Overview: Human MRPS24 full-length ORF ( NP_114403.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. A pseudogene corresponding to this gene is found on chromosome 11. [provided by RefSeq
• Molecular Mass: 45.4 kDa
• AA Sequence: MAASVCSGLLGPRVLSWSRELPCAWRALHTSPVCAKNRAARVRVSKGDKPVTYEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTVEDVFLRKFMWGTFPGCLADQLVLKRRGNQLEICAVVLRQLSPHKYYFLVGYSETLLSYFYKCPVRLHLQTVPSKVVYKYL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MRPS24 mitochondrial ribosomal protein S24 [ Homo sapiens ]
• Official Symbol: MRPS24
• Synonyms: MRPS24; mitochondrial ribosomal protein S24; 28S ribosomal protein S24, mitochondrial; HSPC335; MRP S24; mitochondrial 28S ribosomal protein S24; S24mt; bMRP47; MRP-S24; bMRP-47
• Gene ID: 64951
• mRNA Refseq: NM_032014
• Protein Refseq: NP_114403
• MIM: 611986
• UniProt ID: Q96EL2