Recombinant Full Length Human MRPS25 Protein, GST-tagged
| Cat.No. : | MRPS25-6491HF | 
| Product Overview : | Human MRPS25 full-length ORF ( AAH03590, 1 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 173 amino acids | 
| Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. A pseudogene corresponding to this gene is found on chromosome 4. [provided by RefSeq | 
| Molecular Mass : | 44.77 kDa | 
| AA Sequence : | MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | MRPS25 mitochondrial ribosomal protein S25 [ Homo sapiens ] | 
| Official Symbol | MRPS25 | 
| Synonyms | MRPS25; mitochondrial ribosomal protein S25; MRP-S25; | 
| Gene ID | 64950 | 
| ◆ Recombinant Proteins | ||
| MRPS25-10097M | Recombinant Mouse MRPS25 Protein | +Inquiry | 
| MRPS25-1031H | Recombinant Human MRPS25, His-tagged | +Inquiry | 
| MRPS25-1435H | Recombinant Human MRPS25 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| MRPS25-3438R | Recombinant Rat MRPS25 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| MRPS25-5192C | Recombinant Chicken MRPS25 | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| MRPS25-4141HCL | Recombinant Human MRPS25 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All MRPS25 Products
Required fields are marked with *
My Review for All MRPS25 Products
Required fields are marked with *
  
        
    
      
            