Recombinant Full Length Human MRPS34 Protein, C-Flag-tagged
Cat.No. : | MRPS34-1614HFL |
Product Overview : | Recombinant Full Length Human MRPS34 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 25.5 kDa |
AA Sequence : | MARKKVRPRLIAELARRVRALREQLNRPRDSQLYAVDYETLTRPFSGRRLPVRAWADVRRESRLLQLLGR LPLFGLGRLVTRKSWLWQHDEPCYWRLTRVRPDYTAQNLDHGKAWGILTFKGKTESEAREIEHVMYHDWR LVPKHEEEAFTAFTPAPEDSLASVPYPPLLRAMIIAERQKNGDTSTEEPMLNVQRIRMEPWDYPAKQEDK GRAKGTPVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | MRPS34 mitochondrial ribosomal protein S34 [ Homo sapiens (human) ] |
Official Symbol | MRPS34 |
Synonyms | MRPS12; COXPD32; MRP-S12; MRP-S34 |
Gene ID | 65993 |
mRNA Refseq | NM_023936.2 |
Protein Refseq | NP_076425.1 |
MIM | 611994 |
UniProt ID | P82930 |
◆ Recombinant Proteins | ||
MRPS34-2866R | Recombinant Rhesus monkey MRPS34 Protein, His-tagged | +Inquiry |
MRPS34-4980C | Recombinant Chicken MRPS34 | +Inquiry |
MRPS34-2686R | Recombinant Rhesus Macaque MRPS34 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS34-1038H | Recombinant Human MRPS34, His-tagged | +Inquiry |
Mrps34-4174M | Recombinant Mouse Mrps34 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS34-4136HCL | Recombinant Human MRPS34 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS34 Products
Required fields are marked with *
My Review for All MRPS34 Products
Required fields are marked with *
0
Inquiry Basket