Recombinant Full Length Human MRPS35 Protein, GST-tagged
Cat.No. : | MRPS35-6506HF |
Product Overview : | Human MRPS35 full-length ORF ( NP_068593.2, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 323 amino acids |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that has had confusing nomenclature in the literature. Pseudogenes corresponding to this gene are found on chromosomes 3p, 5q, and 10q. [provided by RefSeq |
Molecular Mass : | 63.2 kDa |
AA Sequence : | MAAAALPAWLSLQSRARTLRAFSTAVYSATPVPTPSLPERTPGNERPPRRKALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKTTDVLTIKTDRCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVKRLLNVT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPS35 mitochondrial ribosomal protein S35 [ Homo sapiens ] |
Official Symbol | MRPS35 |
Synonyms | MRPS35; mitochondrial ribosomal protein S35; 28S ribosomal protein S35, mitochondrial; MDS023; MRPS28; S28mt; S35mt; MRP-S35; mitochondrial ribosomal protein S28; 28S ribosomal protein S28, mitochondrial; MRP-S28; HDCMD11P; MGC104278; DKFZp762P093; |
Gene ID | 60488 |
mRNA Refseq | NM_021821 |
Protein Refseq | NP_068593 |
MIM | 611995 |
UniProt ID | P82673 |
◆ Recombinant Proteins | ||
MRPS35-2687R | Recombinant Rhesus Macaque MRPS35 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS35-3364Z | Recombinant Zebrafish MRPS35 | +Inquiry |
MRPS35-5727M | Recombinant Mouse MRPS35 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS35-5358C | Recombinant Chicken MRPS35 | +Inquiry |
MRPS35-10104M | Recombinant Mouse MRPS35 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS35-4135HCL | Recombinant Human MRPS35 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS35 Products
Required fields are marked with *
My Review for All MRPS35 Products
Required fields are marked with *