Recombinant Full Length Human MS4A15 Protein, GST-tagged

Cat.No. : MS4A15-6403HF
Product Overview : Human MGC35295 full-length ORF ( AAH31610.1, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 147 amino acids
Description : MS4A15 (Membrane Spanning 4-Domains A15) is a Protein Coding gene. An important paralog of this gene is MS4A12.
Molecular Mass : 41.91 kDa
AA Sequence : MVRRGHVGIFFIEGGVPFWGGACFIISGSLSVAAEKNHTSCLVRSSLGTNILSVMAAFAGTAILLMDFGVTNRDVDRGYLAVLTIFTVLEFFTAVIAMHFGCQAIHAQASAPVIFLPNAFSADFNIPSPAASAPPAYDNVAYAQGVV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MS4A15 membrane-spanning 4-domains, subfamily A, member 15 [ Homo sapiens ]
Official Symbol MS4A15
Synonyms MS4A15; membrane-spanning 4-domains, subfamily A, member 15; membrane-spanning 4-domains subfamily A member 15; FLJ34527; MGC35295;
Gene ID 219995
mRNA Refseq NM_001098835
Protein Refseq NP_001092305
UniProt ID Q8N5U1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MS4A15 Products

Required fields are marked with *

My Review for All MS4A15 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon