Recombinant Full Length Human MS4A6E Protein, GST-tagged

Cat.No. : MS4A6E-6548HF
Product Overview : Human MS4A6E full-length ORF ( NP_640342.1, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 147 amino acids
Description : This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.3, among a cluster of family members. [provided by RefSeq
Molecular Mass : 42.3 kDa
AA Sequence : MTSQPISNETIIMLPSNVINFSQAEKPEPTNQGQDSLKKRLQAKVKVIGVHSSLAGSILSALSALVGFILLSVNPAALNPASLQCKLDEKDIPTRLLLSYDYHSPYTMDCHRAKASLAGTLSLMLVSTVLEFCLAVLTAVLQWKQTV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MS4A6E membrane spanning 4-domains A6E [ Homo sapiens (human) ]
Official Symbol MS4A6E
Synonyms MS4A6E; membrane spanning 4-domains A6E; membrane-spanning 4-domains subfamily A member 6E; membrane-spanning 4-domains, subfamily A, member 6E
Gene ID 245802
mRNA Refseq NM_139249
Protein Refseq NP_640342
MIM 608402
UniProt ID Q96DS6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MS4A6E Products

Required fields are marked with *

My Review for All MS4A6E Products

Required fields are marked with *

0
cart-icon
0
compare icon