Recombinant Human MS4A6E Protein, GST-tagged
| Cat.No. : | MS4A6E-5642H |
| Product Overview : | Human MS4A6E full-length ORF ( NP_640342.1, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.3, among a cluster of family members. [provided by RefSeq |
| Molecular Mass : | 42.3 kDa |
| AA Sequence : | MTSQPISNETIIMLPSNVINFSQAEKPEPTNQGQDSLKKRLQAKVKVIGVHSSLAGSILSALSALVGFILLSVNPAALNPASLQCKLDEKDIPTRLLLSYDYHSPYTMDCHRAKASLAGTLSLMLVSTVLEFCLAVLTAVLQWKQTV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MS4A6E membrane spanning 4-domains A6E [ Homo sapiens (human) ] |
| Official Symbol | MS4A6E |
| Synonyms | MS4A6E; membrane spanning 4-domains A6E; membrane-spanning 4-domains subfamily A member 6E; membrane-spanning 4-domains, subfamily A, member 6E |
| Gene ID | 245802 |
| mRNA Refseq | NM_139249 |
| Protein Refseq | NP_640342 |
| MIM | 608402 |
| UniProt ID | Q96DS6 |
| ◆ Recombinant Proteins | ||
| MS4A6E-6548HF | Recombinant Full Length Human MS4A6E Protein, GST-tagged | +Inquiry |
| MS4A6E-5642H | Recombinant Human MS4A6E Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MS4A6E-420HCL | Recombinant Human MS4A6E lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MS4A6E Products
Required fields are marked with *
My Review for All MS4A6E Products
Required fields are marked with *
