Recombinant Full Length Human MSI1 Protein, GST-tagged
Cat.No. : | MSI1-6560HF |
Product Overview : | Human MSI1 full-length ORF ( NP_002433.1, 1 a.a. - 362 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 362 amino acids |
Description : | This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13. [provided by RefSeq |
Molecular Mass : | 65.5 kDa |
AA Sequence : | METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNGYH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MSI1 musashi homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | MSI1 |
Synonyms | MSI1; musashi homolog 1 (Drosophila); Musashi (Drosophila) homolog 1; RNA-binding protein Musashi homolog 1; musashi1; musashi-1; |
Gene ID | 4440 |
mRNA Refseq | NM_002442 |
Protein Refseq | NP_002433 |
MIM | 603328 |
UniProt ID | O43347 |
◆ Recombinant Proteins | ||
MSI1-30259TH | Recombinant Human MSI1 | +Inquiry |
MSI1-1440H | Recombinant Human MSI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MSI1-2184Z | Recombinant Zebrafish MSI1 | +Inquiry |
MSI1-1529HFL | Recombinant Full Length Human MSI1 Protein, C-Flag-tagged | +Inquiry |
MSI1-3789R | Recombinant Rat MSI1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSI1-4116HCL | Recombinant Human MSI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSI1 Products
Required fields are marked with *
My Review for All MSI1 Products
Required fields are marked with *
0
Inquiry Basket