Recombinant Full Length Human MSMB Protein
Cat.No. : | MSMB-318HF |
Product Overview : | Recombinant full length Human Prostate Secretory Protein/PSP with N terminal proprietary tag, 38.65kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 114 amino acids |
Description : | The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene. |
Form : | Liquid |
Molecular Mass : | 38.650kDa inclusive of tags |
AA Sequence : | MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMD LKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYD KDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | MSMB microseminoprotein, beta- [ Homo sapiens ] |
Official Symbol | MSMB |
Synonyms | MSMB; microseminoprotein, beta-; beta-microseminoprotein; IGBF; MSP; MSPB; PN44; PRPS; PSP; PSP 94; PSP57; PSP94 |
Gene ID | 4477 |
mRNA Refseq | NM_002443 |
Protein Refseq | NP_002434 |
MIM | 157145 |
UniProt ID | P08118 |
◆ Recombinant Proteins | ||
MSMB-3450R | Recombinant Rat MSMB Protein, His (Fc)-Avi-tagged | +Inquiry |
MSMB-5656H | Recombinant Human MSMB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MSMB-2875R | Recombinant Rhesus monkey MSMB Protein, His-tagged | +Inquiry |
MSMB-7959H | Recombinant Human MSMB protein, His & S-tagged | +Inquiry |
MSMB-5661H | Recombinant Human MSMB Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSMB-4111HCL | Recombinant Human MSMB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSMB Products
Required fields are marked with *
My Review for All MSMB Products
Required fields are marked with *