Recombinant Full Length Human MSMB Protein

• Cat.No.: MSMB-318HF
• Product Overview: Recombinant full length Human Prostate Secretory Protein/PSP with N terminal proprietary tag, 38.65kDa.

Specification

• Description: The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 38.650kDa inclusive of tags
• Protein Length: 114 amino acids
• AA Sequence: MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMD LKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYD KDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: MSMB microseminoprotein, beta- [ Homo sapiens ]
• Official Symbol: MSMB
• Synonyms: MSMB; microseminoprotein, beta-; beta-microseminoprotein; IGBF; MSP; MSPB; PN44; PRPS; PSP; PSP 94; PSP57; PSP94
• Gene ID: 4477
• mRNA Refseq: NM_002443
• Protein Refseq: NP_002434
• MIM: 157145
• UniProt ID: P08118