Recombinant Full Length Human MT1F Protein, GST-tagged
Cat.No. : | MT1F-6992HF |
Product Overview : | Recombinant Human full-length MT1F(1 a.a. - 61 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 61 amino acids |
Description : | Metallothionein-1F is a protein that in humans is encoded by the MT1F gene. |
Molecular Mass : | 32.45 kDa |
AA Sequence : | MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCCD |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MT1F metallothionein 1F [ Homo sapiens (human) ] |
Official Symbol | MT1F |
Synonyms | MT1F; MT1; metallothionein 1F; metallothionein-1F; MT-1F; MT-IF; metallothionein-IF; metallothionein 1F (functional) |
Gene ID | 4494 |
mRNA Refseq | NM_001301272 |
Protein Refseq | NP_001288201 |
MIM | 156352 |
UniProt ID | P04733 |
◆ Recombinant Proteins | ||
MT1F-1463H | Recombinant Human MT1F Protein (1-59 aa), His-tagged | +Inquiry |
MT1F-125H | Recombinant Human MT1F, GST-tagged | +Inquiry |
MT1F-5244P | Recombinant Pig MT1F protein, Avi-tagged, Biotinylated | +Inquiry |
MT1F-5246P | Recombinant Pig MT1F protein | +Inquiry |
MT1F-5245P | Recombinant Pig MT1F protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MT1F-4102HCL | Recombinant Human MT1F 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MT1F Products
Required fields are marked with *
My Review for All MT1F Products
Required fields are marked with *