Recombinant Full Length Human MT1F Protein, GST-tagged

• Cat.No.: MT1F-6992HF
• Product Overview: Recombinant Human full-length MT1F(1 a.a. - 61 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 61 amino acids
• Description: Metallothionein-1F is a protein that in humans is encoded by the MT1F gene.
• Molecular Mass: 32.45 kDa
• AA Sequence: MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCCD
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MT1F metallothionein 1F [ Homo sapiens (human) ]
• Official Symbol: MT1F
• Synonyms: MT1F; MT1; metallothionein 1F; metallothionein-1F; MT-1F; MT-IF; metallothionein-IF; metallothionein 1F (functional)
• Gene ID: 4494
• mRNA Refseq: NM_001301272
• Protein Refseq: NP_001288201
• MIM: 156352
• UniProt ID: P04733