Recombinant Full Length Human MTAP Protein, C-Flag-tagged
Cat.No. : | MTAP-405HFL |
Product Overview : | Recombinant Full Length Human MTAP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage of both adenine and methionine. The encoded enzyme is deficient in many cancers because this gene and the tumor suppressor p16 gene are co-deleted. Multiple alternatively spliced transcript variants have been described for this gene, but their full-length natures remain unknown. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 31.1 kDa |
AA Sequence : | MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPS KVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPM AEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGI CYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLL PRHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Cysteine and methionine metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | MTAP methylthioadenosine phosphorylase [ Homo sapiens (human) ] |
Official Symbol | MTAP |
Synonyms | BDMF; MSAP; DMSFH; LGMBF; DMSMFH; c86fus; HEL-249 |
Gene ID | 4507 |
mRNA Refseq | NM_002451.4 |
Protein Refseq | NP_002442.2 |
MIM | 156540 |
UniProt ID | Q13126 |
◆ Recombinant Proteins | ||
MTAP-405HFL | Recombinant Full Length Human MTAP Protein, C-Flag-tagged | +Inquiry |
MTAP-2892R | Recombinant Rhesus monkey MTAP Protein, His-tagged | +Inquiry |
MTAP-29502TH | Recombinant Human MTAP, GST-tagged | +Inquiry |
MTAP-457C | Recombinant Cynomolgus Monkey MTAP Protein, His (Fc)-Avi-tagged | +Inquiry |
MTAP-2005H | Recombinant Human MTAP Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTAP-424HCL | Recombinant Human MTAP lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTAP Products
Required fields are marked with *
My Review for All MTAP Products
Required fields are marked with *
0
Inquiry Basket