Recombinant Full Length Human MTAP Protein, GST-tagged
| Cat.No. : | MTAP-6481HF |
| Product Overview : | Human MTAP full-length ORF ( AAH26106, 1 a.a. - 283 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 283 amino acids |
| Description : | This gene encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage of both adenine and methionine. The encoded enzyme is deficient in many cancers because this gene and the tumor suppressor p16 gene are co-deleted. Multiple alternatively spliced transcript variants have been described for this gene, but their full-length natures remain unknown. [provided by RefSeq |
| Molecular Mass : | 56.87 kDa |
| AA Sequence : | MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MTAP methylthioadenosine phosphorylase [ Homo sapiens ] |
| Official Symbol | MTAP |
| Synonyms | MTAP; methylthioadenosine phosphorylase; S-methyl-5-thioadenosine phosphorylase; c86fus; MSAP; MTAPase; MTA phosphorylase; MeSAdo phosphorylase; 5-methylthioadenosine phosphorylase; |
| Gene ID | 4507 |
| mRNA Refseq | NM_002451 |
| Protein Refseq | NP_002442 |
| MIM | 156540 |
| UniProt ID | Q13126 |
| ◆ Recombinant Proteins | ||
| MTAP-10835Z | Recombinant Zebrafish MTAP | +Inquiry |
| Mtap-387H | Recombinant Mouse Mtap Protein, His-tagged | +Inquiry |
| MTAP-457C | Recombinant Cynomolgus Monkey MTAP Protein, His (Fc)-Avi-tagged | +Inquiry |
| Mtap-4204M | Recombinant Mouse Mtap Protein, Myc/DDK-tagged | +Inquiry |
| MTAP-2892R | Recombinant Rhesus monkey MTAP Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MTAP-248HKCL | Human MTAP Knockdown Cell Lysate | +Inquiry |
| MTAP-424HCL | Recombinant Human MTAP lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTAP Products
Required fields are marked with *
My Review for All MTAP Products
Required fields are marked with *
