Recombinant Full Length Human MTARC1 Protein, C-Flag-tagged
Cat.No. : | MTARC1-346HFL |
Product Overview : | Recombinant Full Length Human MTARC1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | As a component of an N-hydroxylated prodrug-converting complex required to reduce N-hydroxylated prodrugs, such as benzamidoxime. Also able to reduce N(omega)-hydroxy-L-arginine (NOHA) and N(omega)-hydroxy-N(delta)-methyl-L-arginine (NHAM) into L-arginine and N(delta)-methyl-L-arginine, respectively. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 37.3 kDa |
AA Sequence : | MGAAGSSALARFVLLAQSRPGWLGVAALGLTAVALGAVAWRRAWPTRRRRLLQQVGTVAQLWIYPVKSCK GVPVSEAECTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKT PTTNAVHKCRVHGLEIEGRDCGEAAAQWITSFLKSQPYRLVHFEPHKRPRRPHQIADLFRPKDQIAYSDT SPFLILSEASLADLNSRLEKKVKATNFRPNIVISGCDVYAEDSWDELLIGDVELKRVMACSRCILTTVDP DTGVMSRKEPLETLKSYRQCDPSERKLYGKSPLFGQYFVLENPGTIKVGDPVYLLGQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | MTARC1 mitochondrial amidoxime reducing component 1 [ Homo sapiens (human) ] |
Official Symbol | MTARC1 |
Synonyms | MARC1; MOSC1 |
Gene ID | 64757 |
mRNA Refseq | NM_022746.4 |
Protein Refseq | NP_073583.3 |
MIM | 614126 |
UniProt ID | Q5VT66 |
◆ Recombinant Proteins | ||
MTARC1-3787H | Recombinant Human MTARC1 Protein (Arg41-Leu335), N-His tagged | +Inquiry |
MTARC1-346HFL | Recombinant Full Length Human MTARC1 Protein, C-Flag-tagged | +Inquiry |
MTARC1-3406H | Recombinant Human MTARC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Mtarc1-3954M | Recombinant Mouse Mtarc1 Protein, Myc/DDK-tagged | +Inquiry |
MTARC1-01H | Recombinant Human MTARC1 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTARC1 Products
Required fields are marked with *
My Review for All MTARC1 Products
Required fields are marked with *