Recombinant Full Length Human MTCH2 Protein, GST-tagged
| Cat.No. : | MTCH2-6483HF |
| Product Overview : | Human MTCH2 full-length ORF ( NP_055157.1, 1 a.a. - 303 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 303 amino acids |
| Description : | This gene encodes a member of the SLC25 family of nuclear-encoded transporters that are localized in the inner mitochondrial membrane. Members of this superfamily are involved in many metabolic pathways and cell functions. Genome-wide association studies in human have identified single-nucleotide polymorphisms in several loci associated with obesity. This gene is one such locus, which is highly expressed in white adipose tissue and adipocytes, and thought to play a regulatory role in adipocyte differentiation and biology. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target, and that its mRNA can give rise to an additional C-terminally extended isoform by use of an alternative in-frame translation termination codon. [provided by RefSeq, Nov 2015] |
| Molecular Mass : | 59.7 kDa |
| AA Sequence : | MADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVIKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGFFAGLVPRLLGDILSLWLCNSLAYLVNTYALDSGVSTMNEMKSYSQAVTGFFASMLTYPFVLVSNLMAVNNCGLAGGCPPYSPIYTSWIDCWCMLQKEGNMSRGNSLFFRKVPFGKTYCCDLKMLI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MTCH2 mitochondrial carrier 2 [ Homo sapiens ] |
| Official Symbol | MTCH2 |
| Synonyms | MTCH2; mitochondrial carrier 2; mitochondrial carrier homolog 2 (C. elegans); mitochondrial carrier homolog 2; SLC25A50; solute carrier family 25; member 50; 2310034D24Rik; met-induced mitochondrial protein; solute carrier family 25, member 50; MIMP; HSPC032; |
| Gene ID | 23788 |
| mRNA Refseq | NM_014342 |
| Protein Refseq | NP_055157 |
| MIM | 613221 |
| UniProt ID | Q9Y6C9 |
| ◆ Recombinant Proteins | ||
| RFL7184HF | Recombinant Full Length Human Mitochondrial Carrier Homolog 2(Mtch2) Protein, His-Tagged | +Inquiry |
| MTCH2-8958Z | Recombinant Zebrafish MTCH2 | +Inquiry |
| MTCH2-3536H | Recombinant Human MTCH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MTCH2-2459H | Recombinant Human MTCH2 Protein, His-tagged | +Inquiry |
| MTCH2-6483HF | Recombinant Full Length Human MTCH2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MTCH2-4089HCL | Recombinant Human MTCH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTCH2 Products
Required fields are marked with *
My Review for All MTCH2 Products
Required fields are marked with *
