Recombinant Full Length Human MTFP1 Protein, GST-tagged
Cat.No. : | MTFP1-6557HF |
Product Overview : | Human MTP18 full-length ORF ( AAH01608, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 166 amino acids |
Description : | MTP18 is a mitochondrial protein and downstream target of the phosphatidylinositol 3-kinase (see PIK3CA, MIM 171834) signaling pathway that plays a role in cell viability and mitochondrial dynamics (Tondera et al., 2004 [PubMed 15155745]).[supplied by OMIM |
Molecular Mass : | 44 kDa |
AA Sequence : | MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MTFP1 mitochondrial fission process 1 [ Homo sapiens (human) ] |
Official Symbol | MTFP1 |
Synonyms | MTFP1; mitochondrial fission process 1; MTP18; HSPC242; mitochondrial fission process protein 1; mitochondrial 18 kDa protein; mitochondrial fission protein MTP18; mitochondrial protein 18 kDa |
Gene ID | 51537 |
mRNA Refseq | NM_001003704 |
Protein Refseq | NP_001003704 |
MIM | 610235 |
UniProt ID | Q9UDX5 |
◆ Recombinant Proteins | ||
MTFP1-5729H | Recombinant Human MTFP1 Protein, GST-tagged | +Inquiry |
RFL15959MF | Recombinant Full Length Mouse Mitochondrial Fission Process Protein 1(Mtfp1) Protein, His-Tagged | +Inquiry |
Mtfp1-4207M | Recombinant Mouse Mtfp1 Protein, Myc/DDK-tagged | +Inquiry |
MTFP1-10954Z | Recombinant Zebrafish MTFP1 | +Inquiry |
MTFP1-2196H | Recombinant Human MTFP1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTFP1-1152HCL | Recombinant Human MTFP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTFP1 Products
Required fields are marked with *
My Review for All MTFP1 Products
Required fields are marked with *