Recombinant Full Length Human MTFR1L Protein, GST-tagged
Cat.No. : | MTFR1L-4617HF |
Product Overview : | Human FAM54B full-length ORF ( AAH17175.1, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 292 amino acids |
Description : | MTFR1L (Mitochondrial Fission Regulator 1 Like) is a Protein Coding gene. An important paralog of this gene is MTFR2. |
Molecular Mass : | 58.4 kDa |
AA Sequence : | MSGMEATVTIPIWQNKPHGAARSVVRRIGTNLPLKPCARASFETLPNISDLCLRDVPPVPTLADIAWIAADEEETYARVRSDTRPLRHTWKPSPLIVMQRNASVPNLRGSEERLLALKKPALPALSRTTELQDELSHLRSQIAKIVAADAASASLTPDFLSPGSSNVSSPLPCFGSSFHSTTSFVISDITEETEVEVPELPSVPLLCSASPECCKPEHKAACSSSEEDDCVSLSKASSFADMMGILKDFHRMKQSQDLNRSLLKEEDPAVLISEVLRRKFALKEEDISRKGN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MTFR1L mitochondrial fission regulator 1 like [ Homo sapiens (human) ] |
Official Symbol | MTFR1L |
Synonyms | FAM54B; family with sequence similarity 54, member B; protein FAM54B; MST116; MSTP116; HYST1888; MTFR1L; mitochondrial fission regulator 1 like |
Gene ID | 56181 |
mRNA Refseq | NM_001099625 |
Protein Refseq | NP_001093095 |
UniProt ID | Q9H019 |
◆ Recombinant Proteins | ||
MTFR1L-2189H | Recombinant Human MTFR1L Protein, MYC/DDK-tagged | +Inquiry |
MTFR1L-4617HF | Recombinant Full Length Human MTFR1L Protein, GST-tagged | +Inquiry |
MTFR1L-3779H | Recombinant Human MTFR1L Protein, GST-tagged | +Inquiry |
MTFR1L-10256Z | Recombinant Zebrafish MTFR1L | +Inquiry |
Mtfr1l-4209M | Recombinant Mouse Mtfr1l Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTFR1L Products
Required fields are marked with *
My Review for All MTFR1L Products
Required fields are marked with *