Recombinant Human MTFR1L Protein, GST-tagged
| Cat.No. : | MTFR1L-3779H | 
| Product Overview : | Human FAM54B full-length ORF ( AAH17175.1, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | MTFR1L (Mitochondrial Fission Regulator 1 Like) is a Protein Coding gene. An important paralog of this gene is MTFR2. | 
| Molecular Mass : | 58.4 kDa | 
| AA Sequence : | MSGMEATVTIPIWQNKPHGAARSVVRRIGTNLPLKPCARASFETLPNISDLCLRDVPPVPTLADIAWIAADEEETYARVRSDTRPLRHTWKPSPLIVMQRNASVPNLRGSEERLLALKKPALPALSRTTELQDELSHLRSQIAKIVAADAASASLTPDFLSPGSSNVSSPLPCFGSSFHSTTSFVISDITEETEVEVPELPSVPLLCSASPECCKPEHKAACSSSEEDDCVSLSKASSFADMMGILKDFHRMKQSQDLNRSLLKEEDPAVLISEVLRRKFALKEEDISRKGN | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | MTFR1L mitochondrial fission regulator 1 like [ Homo sapiens (human) ] | 
| Official Symbol | MTFR1L | 
| Synonyms | FAM54B; family with sequence similarity 54, member B; protein FAM54B; MST116; MSTP116; HYST1888; MTFR1L; mitochondrial fission regulator 1 like | 
| Gene ID | 56181 | 
| mRNA Refseq | NM_001099625 | 
| Protein Refseq | NP_001093095 | 
| UniProt ID | Q9H019 | 
| ◆ Recombinant Proteins | ||
| Mtfr1l-4209M | Recombinant Mouse Mtfr1l Protein, Myc/DDK-tagged | +Inquiry | 
| MTFR1L-3779H | Recombinant Human MTFR1L Protein, GST-tagged | +Inquiry | 
| MTFR1L-10256Z | Recombinant Zebrafish MTFR1L | +Inquiry | 
| MTFR1L-4617HF | Recombinant Full Length Human MTFR1L Protein, GST-tagged | +Inquiry | 
| MTFR1L-2189H | Recombinant Human MTFR1L Protein, MYC/DDK-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All MTFR1L Products
Required fields are marked with *
My Review for All MTFR1L Products
Required fields are marked with *
  
        
    
      
            