Recombinant Full Length Human MTHFD1L Protein, GST-tagged
Cat.No. : | MTHFD1L-6528HF |
Product Overview : | Human MTHFD1L full-length ORF ( AAH08629.1, 1 a.a. - 366 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 366 amino acids |
Description : | One-carbon substituted forms of tetrahydrofolate (THF) are involved in the de novo synthesis of purines and thymidylate and support cellular methylation reactions through the regeneration of methionine from homocysteine. MTHFD1L is an enzyme involved in THF synthesis in mitochondria (Christensen et al., 2005 [PubMed 15611115]).[supplied by OMIM |
Molecular Mass : | 65.6 kDa |
AA Sequence : | MAVLALTDSLADMKARLGRMVVASDKSGQPVTADDLGVTGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSVLADKIALKLVGEEGFVVTEAGFGADIGMEKFFNIKCRASGLVPNVVVLVATVRALKMHGGGPSVTAGVPLKKEYTEENIQLVADGCCNLQKQIQITQLFGVPVVVALNVFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQGFGNLPICMAKTHLSLSHQPDKKGVPRDFILPISDVRASIGAGFIYPLVGTMSTMPGLPTRPCFYDIDLDTETEQVKGLF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MTHFD1L methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like [ Homo sapiens ] |
Official Symbol | MTHFD1L |
Synonyms | MTHFD1L; methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like; formyltetrahydrofolate synthetase domain containing 1 , FTHFSDC1; monofunctional C1-tetrahydrofolate synthase, mitochondrial; 10 formyl THF synthetase; DKFZP586G1517; FLJ21145; mitochondrial C1 tetrahydrofolate synthase; monofunctional C1 tetrahydrofolate synthase; mitochondrial; 10-formyl-THF synthetase; formyltetrahydrofolate synthetase domain containing 1; FTHFSDC1; MTC1THFS; dJ292B18.2; RP1-292B18.2; DKFZp586G1517; |
Gene ID | 25902 |
mRNA Refseq | NM_001242767 |
Protein Refseq | NP_001229696 |
MIM | 611427 |
UniProt ID | Q6UB35 |
◆ Recombinant Proteins | ||
MTHFD1L-12H | Recombinant Human MTHFD1L protein, His-tagged | +Inquiry |
MTHFD1L-8028Z | Recombinant Zebrafish MTHFD1L | +Inquiry |
MTHFD1L-10191M | Recombinant Mouse MTHFD1L Protein | +Inquiry |
MTHFD1L-5703H | Recombinant Human MTHFD1L Protein, GST-tagged | +Inquiry |
MTHFD1L-6528HF | Recombinant Full Length Human MTHFD1L Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTHFD1L-425HCL | Recombinant Human MTHFD1L lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTHFD1L Products
Required fields are marked with *
My Review for All MTHFD1L Products
Required fields are marked with *