Recombinant Full Length Human MTHFR Protein, C-Flag-tagged
Cat.No. : | MTHFR-1253HFL |
Product Overview : | Recombinant Full Length Human MTHFR Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene catalyzes the conversion of 5,10-methylenetetrahydrofolate to 5-methyltetrahydrofolate, a co-substrate for homocysteine remethylation to methionine. Genetic variation in this gene influences susceptibility to occlusive vascular disease, neural tube defects, colon cancer and acute leukemia, and mutations in this gene are associated with methylenetetrahydrofolate reductase deficiency. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 74.4 kDa |
AA Sequence : | MVNEARGNSSLNPCLEGSASSGSESSKDSSRCSTPGLDPERHERLREKMRRRLESGDKWFSLEFFPPRTA EGAVNLISRFDRMAAGGPLYIDVTWHPAGDPGSDKETSSMMIASTAVNYCGLETILHMTCCRQRLEEITG HLHKAKQLGLKNIMALRGDPIGDQWEEEEGGFNYAVDLVKHIRSEFGDYFDICVAGYPKGHPEAGSFEAD LKHLKEKVSAGADFIITQLFFEADTFFRFVKACTDMGITCPIVPGIFPIQGYHSLRQLVKLSKLEVPQEI KDVIEPIKDNDAAIRNYGIELAVSLCQELLASGLVPGLHFYTLNREMATTEVLKRLGMWTEDPRRPLPWA LSAHPKRREEDVRPIFWASRPKSYIYRTQEWDEFPNGRWGNSSSPAFGELKDYYLFYLKSKSPKEELLKM WGEELTSEASVFEVFVLYLSGEPNRNGHKVTCLPWNDEPLAAETSLLKEELLRVNRQGILTINSQPNING KPSSDPIVGWGPSGGYVFQKAYLEFFTSRETAEALLQVLKKYELRVNYHLVNVKGENITNAPELQPNAVT WGIFPGREIIQPTVVDPVSFMFWKDEAFALWIEQWGKLYEEESPSRTIIQYIHDNYFLVNLVDNDFPLDN CLWQVVEDTLELLNRPTQNARETEAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Methane metabolism, One carbon pool by folate |
Full Length : | Full L. |
Gene Name | MTHFR methylenetetrahydrofolate reductase [ Homo sapiens (human) ] |
Official Symbol | MTHFR |
Synonyms | 5,10-methylenetetrahydrofolate reductase (NADPH); methylenetetrahydrofolate reductase intermediate form; OTTHUMP00000002367; OTTHUMP00000002368 |
Gene ID | 4524 |
mRNA Refseq | NM_005957.5 |
Protein Refseq | NP_005948.3 |
MIM | 607093 |
UniProt ID | P42898 |
◆ Recombinant Proteins | ||
MTHFR-670H | Recombinant Human MTHFR Protein (1-656 aa), His-SUMO-tagged | +Inquiry |
MTHFR-1536H | Recombinant Human MTHFR protein, His & T7-tagged | +Inquiry |
MTHFR-1454H | Recombinant Human MTHFR Protein, His (Fc)-Avi-tagged | +Inquiry |
MTHFR-714C | Recombinant Cynomolgus MTHFR Protein, His-tagged | +Inquiry |
Mthfr-4212M | Recombinant Mouse Mthfr Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTHFR-4081HCL | Recombinant Human MTHFR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTHFR Products
Required fields are marked with *
My Review for All MTHFR Products
Required fields are marked with *
0
Inquiry Basket