Recombinant Full Length Human MTPN Protein, GST-tagged
| Cat.No. : | MTPN-6558HF | 
| Product Overview : | Human MTPN full-length ORF ( AAH28093, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 118 amino acids | 
| Description : | The transcript produced from this gene is bi-cistronic and can encode both myotrophin and leucine zipper protein 6. The myotrophin protein is associated with cardiac hypertrophy, where it is involved in the conversion of NFkappa B p50-p65 heterodimers to p50-p50 and p65-p65 homodimers. This protein also has a potential function in cerebellar morphogenesis, and it may be involved in the differentiation of cerebellar neurons, particularly of granule cells. A cryptic ORF at the 3 end of this transcript uses a novel internal ribosome entry site and a non-AUG translation initiation codon to produce leucine zipper protein 6, a 6.4 kDa tumor antigen that is associated with myeloproliferative disease. [provided by RefSeq | 
| Molecular Mass : | 38.72 kDa | 
| AA Sequence : | MCDKEFMWALKNGGLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | MTPN myotrophin [ Homo sapiens ] | 
| Official Symbol | MTPN | 
| Synonyms | MTPN; myotrophin; GCDP; granule cell differentiation protein; MYOTROPHIN; V 1; | 
| Gene ID | 94351 | 
| MIM | 606484 | 
| UniProt ID | P58546 | 
| ◆ Recombinant Proteins | ||
| MTPN-12220Z | Recombinant Zebrafish MTPN | +Inquiry | 
| Mtpn-4223M | Recombinant Mouse Mtpn Protein, Myc/DDK-tagged | +Inquiry | 
| MTPN-5474B | Recombinant Bovine MTPN protein, His-tagged | +Inquiry | 
| MTPN-2180H | Recombinant Human MTPN Protein, MYC/DDK-tagged | +Inquiry | 
| Mtpn-1535M | Recombinant Mouse Mtpn protein, His & GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| MTPN-1153HCL | Recombinant Human MTPN cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTPN Products
Required fields are marked with *
My Review for All MTPN Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            