Recombinant Full Length Human MTPN Protein, GST-tagged
| Cat.No. : | MTPN-6558HF |
| Product Overview : | Human MTPN full-length ORF ( AAH28093, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 118 amino acids |
| Description : | The transcript produced from this gene is bi-cistronic and can encode both myotrophin and leucine zipper protein 6. The myotrophin protein is associated with cardiac hypertrophy, where it is involved in the conversion of NFkappa B p50-p65 heterodimers to p50-p50 and p65-p65 homodimers. This protein also has a potential function in cerebellar morphogenesis, and it may be involved in the differentiation of cerebellar neurons, particularly of granule cells. A cryptic ORF at the 3 end of this transcript uses a novel internal ribosome entry site and a non-AUG translation initiation codon to produce leucine zipper protein 6, a 6.4 kDa tumor antigen that is associated with myeloproliferative disease. [provided by RefSeq |
| Molecular Mass : | 38.72 kDa |
| AA Sequence : | MCDKEFMWALKNGGLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MTPN myotrophin [ Homo sapiens ] |
| Official Symbol | MTPN |
| Synonyms | MTPN; myotrophin; GCDP; granule cell differentiation protein; MYOTROPHIN; V 1; |
| Gene ID | 94351 |
| MIM | 606484 |
| UniProt ID | P58546 |
| ◆ Recombinant Proteins | ||
| MTPN-3475R | Recombinant Rat MTPN Protein, His (Fc)-Avi-tagged | +Inquiry |
| MTPN-716C | Recombinant Cynomolgus MTPN Protein, His-tagged | +Inquiry |
| Mtpn-4223M | Recombinant Mouse Mtpn Protein, Myc/DDK-tagged | +Inquiry |
| MTPN-2904R | Recombinant Rhesus monkey MTPN Protein, His-tagged | +Inquiry |
| MTPN-5474B | Recombinant Bovine MTPN protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MTPN-1153HCL | Recombinant Human MTPN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTPN Products
Required fields are marked with *
My Review for All MTPN Products
Required fields are marked with *
