Recombinant Full Length Human MTPN Protein, GST-tagged
Cat.No. : | MTPN-6558HF |
Product Overview : | Human MTPN full-length ORF ( AAH28093, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 118 amino acids |
Description : | The transcript produced from this gene is bi-cistronic and can encode both myotrophin and leucine zipper protein 6. The myotrophin protein is associated with cardiac hypertrophy, where it is involved in the conversion of NFkappa B p50-p65 heterodimers to p50-p50 and p65-p65 homodimers. This protein also has a potential function in cerebellar morphogenesis, and it may be involved in the differentiation of cerebellar neurons, particularly of granule cells. A cryptic ORF at the 3 end of this transcript uses a novel internal ribosome entry site and a non-AUG translation initiation codon to produce leucine zipper protein 6, a 6.4 kDa tumor antigen that is associated with myeloproliferative disease. [provided by RefSeq |
Molecular Mass : | 38.72 kDa |
AA Sequence : | MCDKEFMWALKNGGLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MTPN myotrophin [ Homo sapiens ] |
Official Symbol | MTPN |
Synonyms | MTPN; myotrophin; GCDP; granule cell differentiation protein; MYOTROPHIN; V 1; |
Gene ID | 94351 |
MIM | 606484 |
UniProt ID | P58546 |
◆ Recombinant Proteins | ||
MTPN-10217M | Recombinant Mouse MTPN Protein | +Inquiry |
MTPN-2724R | Recombinant Rhesus Macaque MTPN Protein, His (Fc)-Avi-tagged | +Inquiry |
Mtpn-1535M | Recombinant Mouse Mtpn protein, His & GST-tagged | +Inquiry |
MTPN-6558HF | Recombinant Full Length Human MTPN Protein, GST-tagged | +Inquiry |
MTPN-2319H | Recombinant Human MTPN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTPN-1153HCL | Recombinant Human MTPN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTPN Products
Required fields are marked with *
My Review for All MTPN Products
Required fields are marked with *
0
Inquiry Basket