Recombinant Full Length Human MTRF1 Protein, GST-tagged
Cat.No. : | MTRF1-6559HF |
Product Overview : | Human MTRF1 full-length ORF ( ENSP00000239852, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 151 amino acids |
Description : | The protein encoded by this gene was determined by in silico methods to be a mitochondrial protein with similarity to the peptide chain release factors (RFs) discovered in bacteria and yeast. The peptide chain release factors direct the termination of translation in response to the peptide chain termination codons. Initially thought to have a role in the termination of mitochondria protein synthesis, a recent publication found no mitochondrial translation release functionality. Multiple alternatively spliced transcript variants have been suggested by mRNA and EST data; however, their full-length natures are not clear. [provided by RefSeq |
Molecular Mass : | 44.6 kDa |
AA Sequence : | MNRHLCVWLFRHPSLNGYLQCHIQLHSHQFRQIHLDTRLQVFRQNRNCILHLLSKNWSRRYCHQDTKMLWKHKALQKYMENLSKEYQTLEQCLQHIPVNEENRRSLNRRHAELAPLAAIYQEIQETEQAIEELESMCKKTESCSVAQAGMQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MTRF1 mitochondrial translational release factor 1 [ Homo sapiens ] |
Official Symbol | MTRF1 |
Synonyms | MTRF1; mitochondrial translational release factor 1; peptide chain release factor 1, mitochondrial; MGC47721; mitochontrial peptide chain release factor 1; MTTRF1; RF1; MRF-1; mtRF-1; MRF1; |
Gene ID | 9617 |
mRNA Refseq | NM_004294 |
Protein Refseq | NP_004285 |
MIM | 604601 |
UniProt ID | O75570 |
◆ Recombinant Proteins | ||
MTRF1-2725R | Recombinant Rhesus Macaque MTRF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MTRF1-2905R | Recombinant Rhesus monkey MTRF1 Protein, His-tagged | +Inquiry |
MTRF1-5795M | Recombinant Mouse MTRF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MTRF1-5732H | Recombinant Human MTRF1 Protein, GST-tagged | +Inquiry |
MTRF1-6559HF | Recombinant Full Length Human MTRF1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTRF1-4067HCL | Recombinant Human MTRF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTRF1 Products
Required fields are marked with *
My Review for All MTRF1 Products
Required fields are marked with *