Recombinant Full Length Human MYEF2 Protein, GST-tagged

Cat.No. : MYEF2-6732HF
Product Overview : Human MYEF2 full-length ORF ( AAH14533, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 211 amino acids
Description : MYEF2 (Myelin Expression Factor 2) is a Protein Coding gene. Diseases associated with MYEF2 include Loeys-Dietz Syndrome. Among its related pathways are Physiological and Pathological Hypertrophy of the Heart and MicroRNAs in cardiomyocyte hypertrophy. GO annotations related to this gene include nucleic acid binding and nucleotide binding. An important paralog of this gene is HNRNPM.
Molecular Mass : 48.95 kDa
AA Sequence : MDGPGFGGMNRIGGGIGFGGLEAMNSMGGFGGVGRMGELYRGAMTSSMERDFGRGDIGINRGFGDSFGRLGGGMGSMNSVTGGMGMGLDRMSSSFDRMGPGIGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFDSPESAEKACRIMNGIKISGREIDVRLDRNA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYEF2 myelin expression factor 2 [ Homo sapiens ]
Official Symbol MYEF2
Synonyms MEF-2; MST156; MSTP156; HsT18564
Gene ID 50804
mRNA Refseq NM_016132
Protein Refseq NP_057216
MIM 619395
UniProt ID Q9P2K5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYEF2 Products

Required fields are marked with *

My Review for All MYEF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon