Recombinant Full Length Human MYEF2 Protein, GST-tagged
Cat.No. : | MYEF2-6732HF |
Product Overview : | Human MYEF2 full-length ORF ( AAH14533, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 211 amino acids |
Description : | MYEF2 (Myelin Expression Factor 2) is a Protein Coding gene. Diseases associated with MYEF2 include Loeys-Dietz Syndrome. Among its related pathways are Physiological and Pathological Hypertrophy of the Heart and MicroRNAs in cardiomyocyte hypertrophy. GO annotations related to this gene include nucleic acid binding and nucleotide binding. An important paralog of this gene is HNRNPM. |
Molecular Mass : | 48.95 kDa |
AA Sequence : | MDGPGFGGMNRIGGGIGFGGLEAMNSMGGFGGVGRMGELYRGAMTSSMERDFGRGDIGINRGFGDSFGRLGGGMGSMNSVTGGMGMGLDRMSSSFDRMGPGIGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFDSPESAEKACRIMNGIKISGREIDVRLDRNA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYEF2 myelin expression factor 2 [ Homo sapiens ] |
Official Symbol | MYEF2 |
Synonyms | MEF-2; MST156; MSTP156; HsT18564 |
Gene ID | 50804 |
mRNA Refseq | NM_016132 |
Protein Refseq | NP_057216 |
MIM | 619395 |
UniProt ID | Q9P2K5 |
◆ Recombinant Proteins | ||
MYEF2-6732HF | Recombinant Full Length Human MYEF2 Protein, GST-tagged | +Inquiry |
MYEF2-2919R | Recombinant Rhesus monkey MYEF2 Protein, His-tagged | +Inquiry |
MYEF2-3098H | Recombinant Human MYEF2 protein, His-tagged | +Inquiry |
MYEF2-3360Z | Recombinant Zebrafish MYEF2 | +Inquiry |
MYEF2-3554H | Recombinant Human MYEF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYEF2 Products
Required fields are marked with *
My Review for All MYEF2 Products
Required fields are marked with *