Recombinant Full Length Human MYF6 Protein, GST-tagged
| Cat.No. : | MYF6-6741HF |
| Product Overview : | Human MYF6 full-length ORF ( NP_002460.1, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 242 amino acids |
| Description : | The protein encoded by this gene is a probable basic helix-loop-helix (bHLH) DNA binding protein involved in muscle differentiation. The encoded protein likely acts as a heterodimer with another bHLH protein. Defects in this gene are a cause of autosomal dominant centronuclear myopathy (ADCNM). [provided by RefSeq, May 2010] |
| Molecular Mass : | 53.4 kDa |
| AA Sequence : | MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDHSRGLVITAKEGGASIDSSASSSLRCLSSIVDSISSEERKLPCVEEVVEK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MYF6 myogenic factor 6 (herculin) [ Homo sapiens ] |
| Official Symbol | MYF6 |
| Synonyms | MYF6; myogenic factor 6 (herculin); myogenic factor 6; bHLHc4; MRF4; muscle-specific regulatory factor 4; class C basic helix-loop-helix protein 4; CNM3; myf-6; |
| Gene ID | 4618 |
| mRNA Refseq | NM_002469 |
| Protein Refseq | NP_002460 |
| MIM | 159991 |
| UniProt ID | P23409 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYF6 Products
Required fields are marked with *
My Review for All MYF6 Products
Required fields are marked with *



