Recombinant Full Length Human MYLPF Protein

• Cat.No.: MYLPF-324HF
• Product Overview: Recombinant full length Human MYLPF with a proprietary tag, MWt 44.7kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 169 amino acids
• Description: Non muscle Myosins are required for cytokinesis at the end of cell division, when a contractile ring near the plasmalemma divides the cytoplasm of the daughter cells, They are involved in cytoplasmic streaming movements in tissues, and especially in acti
• Form: Liquid
• Molecular Mass: 44.700kDa inclusive of tags
• AA Sequence: MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: MYLPF myosin light chain, phosphorylatable, fast skeletal muscle [ Homo sapiens ]
• Official Symbol: MYLPF
• Synonyms: MYLPF; myosin light chain, phosphorylatable, fast skeletal muscle; myosin regulatory light chain 2, skeletal muscle isoform; HUMMLC2B; MRLC2; MYL11; myosin regulatory light chain 2; myosin; light chain 11; regulatory
• Gene ID: 29895
• mRNA Refseq: NM_013292
• Protein Refseq: NP_037424
• MIM: 617378
• UniProt ID: Q96A32