Recombinant Full Length Human MYLPF Protein

Cat.No. : MYLPF-324HF
Product Overview : Recombinant full length Human MYLPF with a proprietary tag, MWt 44.7kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 169 amino acids
Description : Non muscle Myosins are required for cytokinesis at the end of cell division, when a contractile ring near the plasmalemma divides the cytoplasm of the daughter cells, They are involved in cytoplasmic streaming movements in tissues, and especially in acti
Form : Liquid
Molecular Mass : 44.700kDa inclusive of tags
AA Sequence : MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name MYLPF myosin light chain, phosphorylatable, fast skeletal muscle [ Homo sapiens ]
Official Symbol MYLPF
Synonyms MYLPF; myosin light chain, phosphorylatable, fast skeletal muscle; myosin regulatory light chain 2, skeletal muscle isoform; HUMMLC2B; MRLC2; MYL11; myosin regulatory light chain 2; myosin; light chain 11; regulatory
Gene ID 29895
mRNA Refseq NM_013292
Protein Refseq NP_037424
MIM 617378
UniProt ID Q96A32

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYLPF Products

Required fields are marked with *

My Review for All MYLPF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon