Recombinant Full Length Human MYOC Protein, C-Flag-tagged
Cat.No. : | MYOC-296HFL |
Product Overview : | Recombinant Full Length Human MYOC Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | MYOC encodes the protein myocilin, which is believed to have a role in cytoskeletal function. MYOC is expressed in many occular tissues, including the trabecular meshwork, and was revealed to be the trabecular meshwork glucocorticoid-inducible response protein (TIGR). The trabecular meshwork is a specialized eye tissue essential in regulating intraocular pressure, and mutations in MYOC have been identified as the cause of hereditary juvenile-onset open-angle glaucoma. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 56.8 kDa |
AA Sequence : | MRFFCARCCSFGPEMPAVQLLLLACLVWDVGARTAQLRKANDQSGRCQYTFSVASPNESSCPEQSQAMSV IHNLQRDSSTQRLDLEATKARLSSLESLLHQLTLDQAARPQETQEGLQRELGTLRRERDQLETQTRELET AYSNLLRDKSVLEEEKKRLRQENENLARRLESSSQEVARLRRGQCPQTRDTARAVPPGSREVSTWNLDTL AFQELKSELTEVPASRILKESPSGYLRSGEGDTGCGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPY TQETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELN TETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETN IRKQSVANAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWD NLNMVTYDIKLSKMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | MYOC myocilin [ Homo sapiens (human) ] |
Official Symbol | MYOC |
Synonyms | GPOA; JOAG; TIGR; GLC1A; JOAG1 |
Gene ID | 4653 |
mRNA Refseq | NM_000261.2 |
Protein Refseq | NP_000252.1 |
MIM | 601652 |
UniProt ID | Q99972 |
◆ Recombinant Proteins | ||
MYOC-4655H | Recombinant Human MYOC Protein (Ile227-Met504), C-His tagged | +Inquiry |
MYOC-5863M | Recombinant Mouse MYOC Protein, His (Fc)-Avi-tagged | +Inquiry |
MYOC-3528R | Recombinant Rat MYOC Protein, His (Fc)-Avi-tagged | +Inquiry |
MYOC-6605HF | Recombinant Full Length Human MYOC Protein, GST-tagged | +Inquiry |
MYOC-5849H | Recombinant Human MYOC Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYOC-1837HCL | Recombinant Human MYOC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYOC Products
Required fields are marked with *
My Review for All MYOC Products
Required fields are marked with *
0
Inquiry Basket