Recombinant Full Length Human MYOG Protein
Cat.No. : | MYOG-327HF |
Product Overview : | Recombinant full length Human Myogenin with N terminal proprietary tag, 50.75kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 224 amino acids |
Description : | Myogenin is a muscle-specific transcription factor that can induce myogenesis in a variety of cell types in tissue culture. It is a member of a large family of proteins related by sequence homology, the helix-loop-helix (HLH) proteins. It is essential for the development of functional skeletal muscle. |
Form : | Liquid |
Molecular Mass : | 50.750kDa inclusive of tags |
AA Sequence : | MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTEL TLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSV DRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVE ILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPS ECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHS LTSIVDSITVEDVSVAFPDETMPN |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | MYOG myogenin (myogenic factor 4) [ Homo sapiens ] |
Official Symbol | MYOG |
Synonyms | MYOG; myogenin (myogenic factor 4); MYF4; myogenin; bHLHc3 |
Gene ID | 4656 |
mRNA Refseq | NM_002479 |
Protein Refseq | NP_002470 |
MIM | 159980 |
UniProt ID | P15173 |
◆ Recombinant Proteins | ||
MYOG-6610HF | Recombinant Full Length Human MYOG Protein, GST-tagged | +Inquiry |
MYOG-5867M | Recombinant Mouse MYOG Protein, His (Fc)-Avi-tagged | +Inquiry |
MYOG-3209H | Recombinant Human MYOG protein, His-tagged | +Inquiry |
MYOG-327HF | Recombinant Full Length Human MYOG Protein | +Inquiry |
MYOG-8637Z | Recombinant Zebrafish MYOG | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYOG-4004HCL | Recombinant Human MYOG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYOG Products
Required fields are marked with *
My Review for All MYOG Products
Required fields are marked with *