Recombinant Full Length Human MYOG Protein
| Cat.No. : | MYOG-327HF |
| Product Overview : | Recombinant full length Human Myogenin with N terminal proprietary tag, 50.75kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 224 amino acids |
| Description : | Myogenin is a muscle-specific transcription factor that can induce myogenesis in a variety of cell types in tissue culture. It is a member of a large family of proteins related by sequence homology, the helix-loop-helix (HLH) proteins. It is essential for the development of functional skeletal muscle. |
| Form : | Liquid |
| Molecular Mass : | 50.750kDa inclusive of tags |
| AA Sequence : | MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTEL TLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSV DRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVE ILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPS ECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHS LTSIVDSITVEDVSVAFPDETMPN |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | MYOG myogenin (myogenic factor 4) [ Homo sapiens ] |
| Official Symbol | MYOG |
| Synonyms | MYOG; myogenin (myogenic factor 4); MYF4; myogenin; bHLHc3 |
| Gene ID | 4656 |
| mRNA Refseq | NM_002479 |
| Protein Refseq | NP_002470 |
| MIM | 159980 |
| UniProt ID | P15173 |
| ◆ Recombinant Proteins | ||
| MYOG-10351M | Recombinant Mouse MYOG Protein | +Inquiry |
| MYOG-5758C | Recombinant Chicken MYOG | +Inquiry |
| MYOG-327HF | Recombinant Full Length Human MYOG Protein | +Inquiry |
| MYOG-30274TH | Recombinant Human MYOG | +Inquiry |
| MYOG-3209H | Recombinant Human MYOG protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYOG-4004HCL | Recombinant Human MYOG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYOG Products
Required fields are marked with *
My Review for All MYOG Products
Required fields are marked with *
