Recombinant Full Length Human Nadh Dehydrogenase [Ubiquinone] 1 Alpha Subcomplex Subunit 1(Ndufa1) Protein, His-Tagged
| Cat.No. : | RFL4404HF |
| Product Overview : | Recombinant Full Length Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1(NDUFA1) Protein (O15239) (1-70aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-70) |
| Form : | Lyophilized powder |
| AA Sequence : | MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | NDUFA1 |
| Synonyms | NDUFA1; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1; Complex I-MWFE; CI-MWFE; NADH-ubiquinone oxidoreductase MWFE subunit |
| UniProt ID | O15239 |
| ◆ Recombinant Proteins | ||
| NDUFA1-7629Z | Recombinant Zebrafish NDUFA1 | +Inquiry |
| NDUFA1-5608C | Recombinant Chicken NDUFA1 | +Inquiry |
| RFL29650MF | Recombinant Full Length Mouse Nadh Dehydrogenase [Ubiquinone] 1 Alpha Subcomplex Subunit 1(Ndufa1) Protein, His-Tagged | +Inquiry |
| NDUFA1-10510M | Recombinant Mouse NDUFA1 Protein | +Inquiry |
| NDUFA1-5962M | Recombinant Mouse NDUFA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NDUFA1-3926HCL | Recombinant Human NDUFA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFA1 Products
Required fields are marked with *
My Review for All NDUFA1 Products
Required fields are marked with *
