Recombinant Full Length Human NADK2 Protein, C-Flag-tagged
Cat.No. : | NADK2-1856HFL |
Product Overview : | Recombinant Full Length Human NADK2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a mitochondrial kinase that catalyzes the phosphorylation of NAD to yield NADP. Mutations in this gene result in 2,4-dienoyl-CoA reductase deficiency. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 49.3 kDa |
AA Sequence : | MTCYRGFLLGSCCRVAGGRAAALRGPGAGGPAARPRLGGDGGGRRHLGQGQPRELAGCGSRADGGFRPSR VVVVAKTTRYEFEQQRYRYAELSEEDLKQLLALKGSSYSGLLERHHIHTKNVEHIIDSLRNEGIEVRLVK RREYDEETVRWADAVIAAGGDGTMLLAASKVLDRLKPVIGVNTDPERSEGHLCLPVRYTHSFPEALQKFY RGEFRWLWRQRIRLYLEGTGINPVPVDLHEQQLSLNQHNRALNIERAHDERSEASGPQLLPVRALNEVFI GESLSSRASYYEISVDDGPWEKQKSSGLNLCTGTGSKAWSFNINRVATQAVEDVLNIAKRQGNLSLPLNR ELVEKVTNEYNESLLYSPEEPKILFSIREPIANRVFSSSRQRCFSSKVCVRSRCWDACMVVDGGTSFEFN DGAIASMMINKEDELRTVLLEQ myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | NADK2 NAD kinase 2, mitochondrial [ Homo sapiens (human) ] |
Official Symbol | NADK2 |
Synonyms | DECRD; MNADK; NADKD1; C5orf33 |
Gene ID | 133686 |
mRNA Refseq | NM_001085411.3 |
Protein Refseq | NP_001078880.1 |
MIM | 615787 |
UniProt ID | Q4G0N4 |
◆ Recombinant Proteins | ||
NADK2-2543H | Recombinant Human NADK2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NADK2-185H | Recombinant Human NADK2 Protein, His-tagged | +Inquiry |
NADK2-186H | Recombinant Human NADK2 Protein, MYC/DDK-tagged | +Inquiry |
Nadk2-4279M | Recombinant Mouse Nadk2 Protein, Myc/DDK-tagged | +Inquiry |
NADK2-1856HFL | Recombinant Full Length Human NADK2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NADK2-8014HCL | Recombinant Human C5orf33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NADK2 Products
Required fields are marked with *
My Review for All NADK2 Products
Required fields are marked with *
0
Inquiry Basket