Recombinant Full Length Human NAP1L1 Protein, C-Flag-tagged
Cat.No. : | NAP1L1-1386HFL |
Product Overview : | Recombinant Full Length Human NAP1L1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the nucleosome assembly protein (NAP) family. This protein participates in DNA replication and may play a role in modulating chromatin formation and contribute to the regulation of cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms; however, not all have been fully described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 45.2 kDa |
AA Sequence : | MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESL PRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEED EISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPM SFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHK GRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDD DDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | NAP1L1 nucleosome assembly protein 1 like 1 [ Homo sapiens (human) ] |
Official Symbol | NAP1L1 |
Synonyms | NRP; NAP1; NAP1L |
Gene ID | 4673 |
mRNA Refseq | NM_139207.5 |
Protein Refseq | NP_631946.1 |
MIM | 164060 |
UniProt ID | P55209 |
◆ Recombinant Proteins | ||
NAP1L1-1386HFL | Recombinant Full Length Human NAP1L1 Protein, C-Flag-tagged | +Inquiry |
NAP1L1-2958H | Recombinant Human NAP1L1, His-tagged | +Inquiry |
NAP1L1-5675H | Recombinant Human NAP1L1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NAP1L1-30313TH | Recombinant Human NAP1L1, His-tagged | +Inquiry |
NAP1L1-4744H | Recombinant Human Nucleosome Assembly Protein 1-Like 1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAP1L1-3978HCL | Recombinant Human NAP1L1 293 Cell Lysate | +Inquiry |
NAP1L1-3977HCL | Recombinant Human NAP1L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAP1L1 Products
Required fields are marked with *
My Review for All NAP1L1 Products
Required fields are marked with *
0
Inquiry Basket