Recombinant Full Length Human NAPRT Protein, GST-tagged
| Cat.No. : | NAPRT-6839HF |
| Product Overview : | Human NAPRT1 full-length ORF ( NP_660202.2, 1 a.a. - 466 a.a.) recombinant protein with GST-tag at N-terminal was expressed in wheat germ expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 466 amino acids |
| Description : | Nicotinic acid (NA; niacin) is converted by nicotinic acid phosphoribosyltransferase (NAPRT; EC 2.4.2.11) to NA mononucleotide (NaMN), which is then converted to NA adenine dinucleotide (NaAD), and finally to nicotinamide adenine dinucleotide (NAD), which serves as a coenzyme in cellular redox reactions and is an essential component of a variety of processes in cellular metabolism including response to stress. |
| Molecular Mass : | 76 kDa |
| AA Sequence : | MALGYWRAGRARDAAEFELFFRRCPFGGAFALAAGLRDCVRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRRAQGPDGGLTASTYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFVTSFSGSEVPPDPMLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQVAAPPPSS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NAPRT nicotinate phosphoribosyltransferase [ Homo sapiens (human) ] |
| Official Symbol | NAPRT |
| Synonyms | NAPRT; nicotinate phosphoribosyltransferase; NAPRT1; PP3856; nicotinate phosphoribosyltransferase; FHA-HIT-interacting protein; NAPRTase; nicotinate phosphoribosyltransferase domain containing 1; nicotinate phosphoribosyltransferase domain-containing protein 1; nicotinic acid phosphoribosyltransferase; EC 6.3.4.21 |
| Gene ID | 93100 |
| mRNA Refseq | NM_145201 |
| Protein Refseq | NP_660202 |
| MIM | 611552 |
| UniProt ID | Q6XQN6 |
| ◆ Recombinant Proteins | ||
| NAPRT-11136Z | Recombinant Zebrafish NAPRT | +Inquiry |
| NAPRT-1471H | Recombinant Human NAPRT Protein, GST-tagged | +Inquiry |
| NAPRT-1470H | Recombinant Human NAPRT Protein (229-538 aa), His-tagged | +Inquiry |
| NAPRT-6839HF | Recombinant Full Length Human NAPRT Protein, GST-tagged | +Inquiry |
| NAPRT-265H | Recombinant Human NAPRT Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAPRT Products
Required fields are marked with *
My Review for All NAPRT Products
Required fields are marked with *



