Recombinant Full Length Human NARS2 Protein, C-Flag-tagged
Cat.No. : | NARS2-2110HFL |
Product Overview : | Recombinant Full Length Human NARS2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a putative member of the class II family of aminoacyl-tRNA synthetases. These enzymes play a critical role in protein biosynthesis by charging tRNAs with their cognate amino acids. This protein is encoded by the nuclear genome but is likely to be imported to the mitochondrion where it is thought to catalyze the ligation of asparagine to tRNA molecules. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency 24 (COXPD24). |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 53.9 kDa |
AA Sequence : | MLGVRCLLRSVRFCSSAPFPKHKPSAKLSVRDALGAQNASGERIKIQGWIRSVRSQKEVLFLHVNDGSSL ESLQVVADSGLDSRELTFGSSVEVQGQLIKSPSKRQNVELKAEKIKVIGNCDAKDFPIKYKERHPLEYLR QYPHFRCRTNVLGSILRIRSEATAAIHSFFKDSGFVHIHTPIITSNDSEGAGELFQLEPSGKLKVPEENF FNVPAFLTVSGQLHLEVMSGAFTQVFTFGPTFRAENSQSRRHLAEFYMIEAEISFVDSLQDLMQVIEELF KATTMMVLSKCPEDVELCHKFIAPGQKDRLEHMLKNNFLIISYTEAVEILKQASQNFTFTPEWGADLRTE HEKYLVKHCGNIPVFVINYPLTLKPFYMRDNEDGPQHTVAAVDLLVPGVGELFGGGLREERYHFLEERLA RSGLTEVYQWYLDLRRFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFPHSCLL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Aminoacyl-tRNA biosynthesis |
Full Length : | Full L. |
Gene Name | NARS2 asparaginyl-tRNA synthetase 2, mitochondrial [ Homo sapiens (human) ] |
Official Symbol | NARS2 |
Synonyms | SLM5; asnRS; DFNB94 |
Gene ID | 79731 |
mRNA Refseq | NM_024678.6 |
Protein Refseq | NP_078954.4 |
MIM | 612803 |
UniProt ID | Q96I59 |
◆ Recombinant Proteins | ||
Nars2-4295M | Recombinant Mouse Nars2 Protein, Myc/DDK-tagged | +Inquiry |
NARS2-4614Z | Recombinant Zebrafish NARS2 | +Inquiry |
NARS2-10432M | Recombinant Mouse NARS2 Protein | +Inquiry |
Nars2-1815M | Recombinant Mouse Nars2 Protein, His-tagged | +Inquiry |
NARS2-5506H | Recombinant Human NARS2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NARS2-3967HCL | Recombinant Human NARS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NARS2 Products
Required fields are marked with *
My Review for All NARS2 Products
Required fields are marked with *
0
Inquiry Basket