Recombinant Full Length Human NATD1 Protein, GST-tagged

Cat.No. : NATD1-6190HF
Product Overview : Human MGC33894 full-length ORF (BAG54382.1, 1 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 113 amino acids
Description : NATD1 (N-Acetyltransferase Domain Containing 1) is a Protein Coding gene.
Molecular Mass : 39.4 kDa
AA Sequence : MAHSAAAVPLGALEQGCPIRVEHDRRRRQFTVRLNGCHDRAVLLYEYVGKRIVDLQHTEVPDAYRGRGIAKHLAKAALDFVVEEDLKAHLTCWYIQKYVKENPLPQYLERLQP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NATD1 N-acetyltransferase domain containing 1 [ Homo sapiens (human) ]
Official Symbol NATD1
Synonyms NATD1; N-acetyltransferase domain containing 1; Gtlf3b; C17orf103; protein NATD1; N-acetyltransferase domain-containing protein 1; gene trap locus F3b; protein GTLF3B; transcript expressed during hematopoiesis 2
Gene ID 256302
mRNA Refseq NM_152914
Protein Refseq NP_690878
UniProt ID Q8N6N6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NATD1 Products

Required fields are marked with *

My Review for All NATD1 Products

Required fields are marked with *

0
cart-icon