Recombinant Full Length Human NATD1 Protein, GST-tagged
Cat.No. : | NATD1-6190HF |
Product Overview : | Human MGC33894 full-length ORF (BAG54382.1, 1 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 113 amino acids |
Description : | NATD1 (N-Acetyltransferase Domain Containing 1) is a Protein Coding gene. |
Molecular Mass : | 39.4 kDa |
AA Sequence : | MAHSAAAVPLGALEQGCPIRVEHDRRRRQFTVRLNGCHDRAVLLYEYVGKRIVDLQHTEVPDAYRGRGIAKHLAKAALDFVVEEDLKAHLTCWYIQKYVKENPLPQYLERLQP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NATD1 N-acetyltransferase domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | NATD1 |
Synonyms | NATD1; N-acetyltransferase domain containing 1; Gtlf3b; C17orf103; protein NATD1; N-acetyltransferase domain-containing protein 1; gene trap locus F3b; protein GTLF3B; transcript expressed during hematopoiesis 2 |
Gene ID | 256302 |
mRNA Refseq | NM_152914 |
Protein Refseq | NP_690878 |
UniProt ID | Q8N6N6 |
◆ Recombinant Proteins | ||
NATD1-2112Z | Recombinant Zebrafish NATD1 | +Inquiry |
NATD1-4323H | Recombinant Human NATD1 Protein, GST-tagged | +Inquiry |
NATD1-3100H | Recombinant Human NATD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Natd1-3331M | Recombinant Mouse Natd1 Protein, Myc/DDK-tagged | +Inquiry |
NATD1-6190HF | Recombinant Full Length Human NATD1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NATD1-8241HCL | Recombinant Human C17orf103 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NATD1 Products
Required fields are marked with *
My Review for All NATD1 Products
Required fields are marked with *