Recombinant Full Length Human NDUFV1-DT Protein, GST-tagged

• Cat.No.: NDUFV1-DT-1876HF
• Product Overview: Human NDUFV1-DT full-length ORF ( NP_775849.1, 1 a.a. - 251 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 251 amino acids
• Description: NDUFV1-DT (NDUFV1 Divergent Transcript) is an RNA Gene, and is affiliated with the lncRNA class.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 54.3 kDa
• AA Sequence: MTQLPELGLRSPNNKSPTGPHPLEHLLARLLKRRRRSTLMSSPRSLLCSISGPGSHLLSTHPILCHSVYQPPQPASRPQAKRYQGLLPVPLAPHPLCLSGQLYLPNIPCTVIDGCGPVISHLKLTMYPWGLPPSHLGSSSPFSANMEQWDYYKSQTRFAPFLPESFCGSPLPSEQSSRPFGLAFKVLCAATCQPPQFQLLWLCPYKLDLHQRICLPPNLALVLLGALWTSPPPGSFLQPPYNRPYKLYKTN
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NDUFV1-DT NDUFV1 divergent transcript [ Homo sapiens (human) ]
• Official Symbol: NDUFV1-DT
• Synonyms: C11orf72
• Gene ID: 100505621
• mRNA Refseq: NM_173578.1
• Protein Refseq: NP_775849.1
• UniProt ID: Q8NBR9