Recombinant Full Length Human NDUFV2 Protein
Cat.No. : | NDUFV2-333HF |
Product Overview : | Recombinant full length Human NDUFV2 with a N terminal proprietary tag; Predicted MWt 53.46 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 249 amino acids |
Description : | The NADH-ubiquinone oxidoreductase complex (complex I) of the mitochondrial respiratory chain catalyzes the transfer of electrons from NADH to ubiquinone, and consists of at least 43 subunits. The complex is located in the inner mitochondrial membrane. This gene encodes the 24 kDa subunit of complex I, and is involved in electron transfer. Mutations in this gene are implicated in Parkinsons disease, bipolar disorder, schizophrenia, and have been found in one case of early onset hypertrophic cardiomyopathy and encephalopathy. A non-transcribed pseudogene of this locus is found on chromosome 19. |
Form : | Liquid |
Molecular Mass : | 53.460kDa inclusive of tags |
AA Sequence : | MFFSAALRARAAGLTAHWGRHVRNLHKTAMQNGAGGALFV HRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVL PVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYT MYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKV GETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKD IEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKG PGFGVQAGL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | NDUFV2 NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa [ Homo sapiens ] |
Official Symbol | NDUFV2 |
Synonyms | NDUFV2; NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa; NADH dehydrogenase (ubiquinone) flavoprotein 2 (24kD); NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial; CI 24k; complex I 24kDa subunit; NADH dehydrogenase [ubiquinone] flavoprot |
Gene ID | 4729 |
mRNA Refseq | NM_021074 |
Protein Refseq | NP_066552 |
MIM | 600532 |
UniProt ID | P19404 |
◆ Recombinant Proteins | ||
NDUFV2-3604R | Recombinant Rat NDUFV2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDUFV2-5223H | Recombinant Human NDUFV2 protein, GST-tagged | +Inquiry |
NDUFV2-1244H | Recombinant Human NDUFV2, His-tagged | +Inquiry |
NDUFV2-2992R | Recombinant Rhesus monkey NDUFV2 Protein, His-tagged | +Inquiry |
NDUFV2-333HF | Recombinant Full Length Human NDUFV2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFV2-3891HCL | Recombinant Human NDUFV2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NDUFV2 Products
Required fields are marked with *
My Review for All NDUFV2 Products
Required fields are marked with *
0
Inquiry Basket