Recombinant Full Length Human NDUFV2 Protein
Cat.No. : | NDUFV2-333HF |
Product Overview : | Recombinant full length Human NDUFV2 with a N terminal proprietary tag; Predicted MWt 53.46 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The NADH-ubiquinone oxidoreductase complex (complex I) of the mitochondrial respiratory chain catalyzes the transfer of electrons from NADH to ubiquinone, and consists of at least 43 subunits. The complex is located in the inner mitochondrial membrane. This gene encodes the 24 kDa subunit of complex I, and is involved in electron transfer. Mutations in this gene are implicated in Parkinsons disease, bipolar disorder, schizophrenia, and have been found in one case of early onset hypertrophic cardiomyopathy and encephalopathy. A non-transcribed pseudogene of this locus is found on chromosome 19. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 53.460kDa inclusive of tags |
Protein Length : | 249 amino acids |
AA Sequence : | MFFSAALRARAAGLTAHWGRHVRNLHKTAMQNGAGGALFV HRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVL PVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYT MYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKV GETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKD IEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKG PGFGVQAGL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | NDUFV2 NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa [ Homo sapiens ] |
Official Symbol : | NDUFV2 |
Synonyms : | NDUFV2; NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa; NADH dehydrogenase (ubiquinone) flavoprotein 2 (24kD); NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial; CI 24k; complex I 24kDa subunit; NADH dehydrogenase [ubiquinone] flavoprot |
Gene ID : | 4729 |
mRNA Refseq : | NM_021074 |
Protein Refseq : | NP_066552 |
MIM : | 600532 |
UniProt ID : | P19404 |
Products Types
◆ Recombinant Protein | ||
Ndufv2-4349M | Recombinant Mouse Ndufv2 Protein, Myc/DDK-tagged | +Inquiry |
NDUFV2-3604R | Recombinant Rat NDUFV2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDUFV2-5995M | Recombinant Mouse NDUFV2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDUFV2-2811R | Recombinant Rhesus Macaque NDUFV2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDUFV2-11010Z | Recombinant Zebrafish NDUFV2 | +Inquiry |
◆ Lysates | ||
NDUFV2-3891HCL | Recombinant Human NDUFV2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket