Recombinant Full Length Human Neuromedin-U Receptor 2(Nmur2) Protein, His-Tagged
Cat.No. : | RFL12847HF |
Product Overview : | Recombinant Full Length Human Neuromedin-U receptor 2(NMUR2) Protein (Q9GZQ4) (1-415aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-415) |
Form : | Lyophilized powder |
AA Sequence : | MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSVVYVPIFVVGV IGNVLVCLVILQHQAMKTPTNYYLFSLAVSDLLVLLLGMPLEVYEMWRNYPFLFGPVGCY FKTALFETVCFASILSITTVSVERYVAILHPFRAKLQSTRRRALRILGIVWGFSVLFSLP NTSIHGIKFHYFPNGSLVPGSATCTVIKPMWIYNFIIQVTSFLFYLLPMTVISVLYYLMA LRLKKDKSLEADEGNANIQRPCRKSVNKMLFVLVLVFAICWAPFHIDRLFFSFVEEWSES LAAVFNLVHVVSGVFFYLSSAVNPIIYNLLSRRFQAAFQNVISSFHKQWHSQHDPQLPPA QRNIFLTECHFVELTEDIGPQFPCQSSMHNSHLPAALSSEQMSRTNYQSFHFNKT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NMUR2 |
Synonyms | NMUR2; NMU2R; TGR1; Neuromedin-U receptor 2; NMU-R2; G-protein coupled receptor FM-4; G-protein coupled receptor TGR-1 |
UniProt ID | Q9GZQ4 |
◆ Recombinant Proteins | ||
RFL12847HF | Recombinant Full Length Human Neuromedin-U Receptor 2(Nmur2) Protein, His-Tagged | +Inquiry |
NMUR2-3671R | Recombinant Rat NMUR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NMUR2-6614HF | Recombinant Full Length Human NMUR2 Protein | +Inquiry |
NMUR2-10757M | Recombinant Mouse NMUR2 Protein | +Inquiry |
RFL30209BF | Recombinant Full Length Bovine Neuromedin-U Receptor 2(Nmur2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NMUR2-3780HCL | Recombinant Human NMUR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NMUR2 Products
Required fields are marked with *
My Review for All NMUR2 Products
Required fields are marked with *
0
Inquiry Basket