Recombinant Full Length Human NKAIN1 Protein, GST-tagged
| Cat.No. : | NKAIN1-6646HF |
| Product Overview : | Human NKAIN1 full-length ORF (BAB14196.1, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 163 amino acids |
| Description : | NKAIN1 is a member of a family of mammalian proteins with similarity to Drosophila Nkain and interacts with the beta subunit of Na,K-ATPase (ATP1B1; MIM 182330) (Gorokhova et al., 2007 [PubMed 17606467]).[supplied by OMIM |
| Molecular Mass : | 45 kDa |
| AA Sequence : | MAVILGIFGTVQYRSRYLILYAAWLVLWVGWNAFIICFYLEVGQLSQDRDFIMTFNTSLHRSWWMENGPGCLVTPVLNSRLALEDHHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYVSKVFLEEEDSFDFIGGFDSYGYQAPQKTSHLQLQPLYTSG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NKAIN1 Na+/K+ transporting ATPase interacting 1 [ Homo sapiens ] |
| Official Symbol | NKAIN1 |
| Synonyms | NKAIN1; Na+/K+ transporting ATPase interacting 1; FAM77C, family with sequence similarity 77, member C; sodium/potassium-transporting ATPase subunit beta-1-interacting protein 1; FLJ12650; family with sequence similarity 77, member C; Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 1; FAM77C; |
| Gene ID | 79570 |
| mRNA Refseq | NM_024522 |
| Protein Refseq | NP_078798 |
| MIM | 612871 |
| UniProt ID | Q4KMZ8 |
| ◆ Cell & Tissue Lysates | ||
| NKAIN1-3822HCL | Recombinant Human NKAIN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKAIN1 Products
Required fields are marked with *
My Review for All NKAIN1 Products
Required fields are marked with *




